Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE AND REFINEMENT OF THE OXIDIZED P21 FORM OF UTEROGLOBIN AT 1.64 ANGSTROMS RESOLUTION
 
Authors :  R. Bally, J. Delettre
Date :  17 May 89  (Deposition) - 15 Oct 89  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.64
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Steroid Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  R. Bally, J. Delettre
Structure And Refinement Of The Oxidized P21 Form Of Uteroglobin At 1. 64 A Resolution.
J. Mol. Biol. V. 206 153 1989
PubMed-ID: 2704039  |  Reference-DOI: 10.1016/0022-2836(89)90530-5
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - UTEROGLOBIN
    Chains: A, B
    Engineered: YES
    Organism Common: RABBIT
    Organism Scientific: ORYCTOLAGUS CUNICULUS
    Organism Taxid: 9986

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2UTG)

(-) Sites  (0, 0)

(no "Site" information available for 2UTG)

(-) SS Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1A:3 -B:69
2A:69 -B:3

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2UTG)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2UTG)

(-) PROSITE Motifs  (1, 2)

Asymmetric/Biological Unit (1, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1SCGBPS51311 Secretoglobin (SCGB) family profile.UTER_RABIT22-91
 		  2A:1-70
B:1-70

(-) Exons   (2, 4)

Asymmetric/Biological Unit (2, 4)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.1ENSOCUT000000142461ENSOCUE00000248200Un0019:1873206-1873105102UTER_RABIT1-19190--
1.2ENSOCUT000000142462ENSOCUE00000166213Un0019:1870818-1870631188UTER_RABIT19-81632A:1-60
B:1-60		60
60
1.3ENSOCUT000000142463ENSOCUE00000166218Un0019:1870298-1870126173UTER_RABIT82-91102A:61-70
B:61-70		10
10

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:70
 aligned with UTER_RABIT | P02779 from UniProtKB/Swiss-Prot  Length:91

    Alignment length:70
                                    31        41        51        61        71        81        91
            UTER_RABIT   22 GICPRFAHVIENLLLGTPSSYETSLKEFEPDDTMKDAGMQMKKVLDSLPQTTRENIMKLTEKIVKSPLCM 91
               SCOP domains d2utga_ A: Uteroglobin                                                 SCOP domains
               CATH domains 2utgA00 A:1-70 Uteroglobin                                             CATH domains
               Pfam domains ---------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhhhhhhh....hhhhhh.......hhhhhhhhhhhhhh....hhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE SCGB  PDB: A:1-70 UniProt: 22-91                                       PROSITE
               Transcript 1 Exon 1.2  PDB: A:1-60 UniProt: 19-81 [INCOMPLETE]           Exon 1.3   Transcript 1
                  2utg A  1 GICPRFAHVIENLLLGTPSSYETSLKEFEPDDTMKDAGMQMKKVLDSLPQTTRENIMKLTEKIVKSPLCM 70
                                    10        20        30        40        50        60        70


Chain B from PDB  Type:PROTEIN  Length:70
 aligned with UTER_RABIT | P02779 from UniProtKB/Swiss-Prot  Length:91

    Alignment length:70
                                    31        41        51        61        71        81        91
            UTER_RABIT   22 GICPRFAHVIENLLLGTPSSYETSLKEFEPDDTMKDAGMQMKKVLDSLPQTTRENIMKLTEKIVKSPLCM 91
               SCOP domains d2utgb_ B: Uteroglobin                                                 SCOP domains
               CATH domains 2utgB00 B:1-70 Uteroglobin                                             CATH domains
           Pfam domains (1) --Uteroglobin-2utgB01 B:3-69                                         - Pfam domains (1)
           Pfam domains (2) --Uteroglobin-2utgB02 B:3-69                                         - Pfam domains (2)
         Sec.struct. author ....hhhhhhhhhh....hhhhhh.......hhhhhhhhhhhhhh....hhhhhhhhhhhhhh....... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE SCGB  PDB: B:1-70 UniProt: 22-91                                       PROSITE
               Transcript 1 Exon 1.2  PDB: B:1-60 UniProt: 19-81 [INCOMPLETE]           Exon 1.3   Transcript 1
                  2utg B  1 GICPRFAHVIENLLLGTPSSYETSLKEFEPDDTMKDAGMQMKKVLDSLPQTTRENIMKLTEKIVKSPLCM 70
                                    10        20        30        40        50        60        70
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: All alpha proteins (14657)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: Uteroglobin (2)

(-) Gene Ontology  (17, 17)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (UTER_RABIT | P02779)
molecular function
    GO:0008289    lipid binding    Interacting selectively and non-covalently with a lipid.
    GO:0019834    phospholipase A2 inhibitor activity    Stops, prevents or reduces the activity of the enzyme phospholipase A2.
    GO:0005496    steroid binding    Interacting selectively and non-covalently with a steroid, any of a large group of substances that have in common a ring system based on 1,2-cyclopentanoperhydrophenanthrene.
biological process
    GO:0042130    negative regulation of T cell proliferation    Any process that stops, prevents or reduces the rate or extent of T cell proliferation.
    GO:0043086    negative regulation of catalytic activity    Any process that stops or reduces the activity of an enzyme.
    GO:0032689    negative regulation of interferon-gamma production    Any process that stops, prevents, or reduces the frequency, rate, or extent of interferon-gamma production. Interferon-gamma is also known as type II interferon.
    GO:0032696    negative regulation of interleukin-13 production    Any process that stops, prevents, or reduces the frequency, rate, or extent of interleukin-13 production.
    GO:0032713    negative regulation of interleukin-4 production    Any process that stops, prevents, or reduces the frequency, rate, or extent of interleukin-4 production.
    GO:0032714    negative regulation of interleukin-5 production    Any process that stops, prevents, or reduces the frequency, rate, or extent of interleukin-5 production.
    GO:0000122    negative regulation of transcription from RNA polymerase II promoter    Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
    GO:0050727    regulation of inflammatory response    Any process that modulates the frequency, rate or extent of the inflammatory response, the immediate defensive reaction (by vertebrate tissue) to infection or injury caused by chemical or physical agents.
    GO:0043488    regulation of mRNA stability    Any process that modulates the propensity of mRNA molecules to degradation. Includes processes that both stabilize and destabilize mRNAs.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
    GO:0070062    extracellular exosome    A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
    GO:0005576    extracellular region    The space external to the outermost structure of a cell. For cells without external protective or external encapsulating structures this refers to space outside of the plasma membrane. This term covers the host cell environment outside an intracellular parasite.
    GO:0005622    intracellular    The living contents of a cell; the matter contained within (but not including) the plasma membrane, usually taken to exclude large vacuoles and masses of secretory or ingested material. In eukaryotes it includes the nucleus and cytoplasm.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2utg)
 
  Sites
(no "Sites" information available for 2utg)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2utg)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)
Molmol
  protein, nucleic acid: cartoon; ligands: spacefill; active site: sticks
[ mono GIF format | stereo GIF format ] (automatic, in case of more than 1 NMR structures only model 1 is shown)
Prepi
  C alpha wire, SS bonds, labeling, chain-specific coloring; sequence
[ mono GIF format | stereo GIF format ]
  ribbon, secondary structure, SS bonds, chain-specific coloring; different view
[ mono GIF format | stereo GIF format ]

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2utg
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  UTER_RABIT | P02779
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  UTER_RABIT | P02779
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        UTER_RABIT | P02779: 1utg

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2UTG)