Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  THE SOLUTION STRUCTURE OF MEMBRANE PROTEIN
 
Authors :  Y. Kuwahara, S. Unzai, T. Nagata, H. Hiroaki
Date :  13 May 08  (Deposition) - 26 May 09  (Release) - 26 May 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
Keywords :  Membrane Protein, Spfh Domain (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Y. Kuwahara, S. Unzai, T. Nagata, H. Hiroaki
The Solution Structure Of Membrane Protein
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - HYPOTHETICAL MEMBRANE PROTEIN
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Strain: BL21 CODONPLUS(DE3)-RIL
    Expression System Taxid: 562
    Expression System Vector: PGEX-4T3
    Expression System Vector Type: VECTOR
    Fragment: UNP RESIDUES 66-174
    Gene: PH0470
    Organism Scientific: PYROCOCCUS HORIKOSHII
    Organism Taxid: 53953
    Strain: OT3

 Structural Features

(-) Chains, Units

  
NMR Structure (20x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2RPB)

(-) Sites  (0, 0)

(no "Site" information available for 2RPB)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2RPB)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2RPB)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2RPB)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2RPB)

(-) Exons   (0, 0)

(no "Exon" information available for 2RPB)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:113
 aligned with O58205_PYRHO | O58205 from UniProtKB/TrEMBL  Length:298

    Alignment length:113
                                    71        81        91       101       111       121       131       141       151       161       171   
         O58205_PYRHO    62 RVKIVDLREHVIDVPPQEVICKDNVVVTVDAVVYYQVIDPVKAVYNVSDFLMAIVKLAQTNLRAIIGEMELDETLSGRDIINARLREELDKITDRWGVKITRVEIQRIDPPKD 174
               SCOP domains ----------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----Band_7-2rpbA01 A:66-174                                                                                       Pfam domains
         Sec.struct. author .........eeee...eeee.....eeee.eeeeeee..........hhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhh...ee...eee........ Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------- Transcript
                 2rpb A  62 GSDHVDLREHVIDVPPQEVICKDNVVVTVDAVVYYQVIDPVKAVYNVSDFLMAIVKLAQTNLRAIIGEMELDETLSGRDIINARLREELDKITDRWGVKITRVEIQRIDPPKD 174
                                    71        81        91       101       111       121       131       141       151       161       171
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2RPB)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2RPB)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: SPFH (3)

(-) Gene Ontology  (2, 2)

NMR Structure(hide GO term definitions)
Chain A   (O58205_PYRHO | O58205)
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2rpb)
 
  Sites
(no "Sites" information available for 2rpb)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2rpb)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2rpb
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  O58205_PYRHO | O58205
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  O58205_PYRHO | O58205
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2RPB)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2RPB)