|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
NMR Structure (1, 2)
|
Sites (2, 2)
NMR Structure (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2ROB) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2ROB) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2ROB) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2ROB) |
Exons (0, 0)| (no "Exon" information available for 2ROB) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:70 aligned with Q39890_SOYBN | Q39890 from UniProtKB/TrEMBL Length:150 Alignment length:70 90 100 110 120 130 140 150 Q39890_SOYBN 81 DAEEELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEEVEQMIKEADLDGDGQVNYEEFVKMMMTVR 150 SCOP domains d2roba_ A: automated matches SCOP domains CATH domains ---------------------------------------------------------------------- CATH domains Pfam domains (1) ----------------------------------------efhand-2robA01 A:120-148 - Pfam domains (1) Pfam domains (2) ----------------------------------------efhand-2robA02 A:120-148 - Pfam domains (2) SAPs(SNPs) ---------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------- Transcript 2rob A 80 DAEEELKEAFKVFDKDQNGYISASELRHVMINLGEKLTDEEVEQMIKEADLDGDGQVNYEEFVKMMMTVR 149 89 99 109 119 129 139 149
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2ROB) |
Pfam Domains (1, 2)
NMR Structure
|
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A (Q39890_SOYBN | Q39890)
|
||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|