|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 2)
NMR Structure (1, 2)
|
Sites (2, 2)
NMR Structure (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2RO8) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2RO8) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2RO8) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2RO8) |
Exons (0, 0)| (no "Exon" information available for 2RO8) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:79 aligned with Q6LEG8_SOYBN | Q6LEG8 from UniProtKB/TrEMBL Length:149 Alignment length:79 11 21 31 41 51 61 71 Q6LEG8_SOYBN 2 ADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDT 80 SCOP domains d2ro8a_ A: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------- Transcript 2ro8 A 1 ADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMARKMKDT 79 10 20 30 40 50 60 70
|
||||||||||||||||||||
SCOP Domains (1, 1)
NMR Structure
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2RO8) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2RO8) |
Gene Ontology (2, 2)|
NMR Structure(hide GO term definitions) Chain A (Q6LEG8_SOYBN | Q6LEG8)
|
||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|