Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  GLUTATHIONE PEROXIDASE-TYPE TRYPAREDOXIN PEROXIDASE, REDUCED FORM
 
Authors :  J. Melchers, K. Feher, M. Diechtierow, L. Krauth-Siegel, C. Muhle-Gol
Date :  09 Oct 07  (Deposition) - 29 Jul 08  (Release) - 16 Oct 13  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
NMR Structure *:  A  (1x)
Keywords :  Tryparedoxin, Peroxidase, Reuced, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Melchers, M. Diechtierow, K. Feher, I. Sinning, I. Tews, R. L. Krauth-Siegel, C. Muhle-Goll
Structural Basis For A Distinct Catalytic Mechanism In Trypanosoma Brucei Tryparedoxin Peroxidase
J. Biol. Chem. V. 283 30401 2008
PubMed-ID: 18684708  |  Reference-DOI: 10.1074/JBC.M803563200

(-) Compounds

Molecule 1 - GLUTATHIONE PEROXIDASE-LIKE PROTEIN
    Chains: A
    EC Number: 1.11.1.9
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: RESIDUES 10-176
    Gene: GPX3
    Mutation: YES
    Organism Scientific: TRYPANOSOMA BRUCEI
    Organism Taxid: 5691
    Synonym: TRYPANOTHIONE/TRYPAREDOXIN DEPENDENT PEROXIDASE 3

 Structural Features

(-) Chains, Units

  1
NMR Structure (20x): A
NMR Structure * (1x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2RM6)

(-) Sites  (0, 0)

(no "Site" information available for 2RM6)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2RM6)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2RM6)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2RM6)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2RM6)

(-) Exons   (0, 0)

(no "Exon" information available for 2RM6)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:167
 aligned with Q869A5_9TRYP | Q869A5 from UniProtKB/TrEMBL  Length:176

    Alignment length:167
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       
         Q869A5_9TRYP    10 SAASSIFDFEVLDADHKPYNLVQHKGSPLLIYNVASKCGYTKGGYETATALYNKYKSQGFTVLAFPCNQFGGQEPGTEEEIKEFVCTKFKAEFPIMAKINVNGENAHPLYEYMKKTKPGILATKAIKWNFTSFLIDRDGVPVERFSPGASVKDIEEKLIPLLGSARL 176
               SCOP domains d2rm6a_ A: automated matches                                                                                                                                            SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -----GSHPx-2rm6A01 A:15-123                                                                                       ----------------------------------------------------- Pfam domains
         Sec.struct. author ....hhhhh.ee.....eehhhhhh...eeeee.........hhhhhhhhhhhhhh.....eeee.............hhhhhh......................hhhhhhhhhhh..............eeee.....eee......hhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2rm6 A  10 GMGSSIFDFEVLDADHKPYNLVQHKGSPLLIYNVASKCGYTKGGYETATTLYNKYKSQGFTVLAFPSNQFGGQEPGNEEEIKEFVCTKFKAEFPIMAKINVNGENAHPLYEYMKKTKPGILATKAIKWNFTSFLIDRDGVPVERFSPGASVKDIEEKLIPLLGSARL 176
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Alpha and beta proteins (a/b) (23833)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2RM6)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: Thioredoxin (367)

(-) Gene Ontology  (6, 6)

NMR Structure(hide GO term definitions)
Chain A   (Q869A5_9TRYP | Q869A5)
molecular function
    GO:0004602    glutathione peroxidase activity    Catalysis of the reaction: 2 glutathione + hydrogen peroxide = oxidized glutathione + 2 H2O.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0004601    peroxidase activity    Catalysis of the reaction: donor + hydrogen peroxide = oxidized donor + 2 H2O.
biological process
    GO:0098869    cellular oxidant detoxification    Any process carried out at the cellular level that reduces or removes the toxicity superoxide radicals or hydrogen peroxide.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
    GO:0006979    response to oxidative stress    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of oxidative stress, a state often resulting from exposure to high levels of reactive oxygen species, e.g. superoxide anions, hydrogen peroxide (H2O2), and hydroxyl radicals.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2rm6)
 
  Sites
(no "Sites" information available for 2rm6)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2rm6)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2rm6
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q869A5_9TRYP | Q869A5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  1.11.1.9
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q869A5_9TRYP | Q869A5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q869A5_9TRYP | Q869A5: 2rm5 3dwv

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2RM6)