Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF APO F. GRAMINEARUM TRI101
 
Authors :  G. S. Garvey, I. Rayment
Date :  17 Oct 07  (Deposition) - 11 Dec 07  (Release) - 21 Dec 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.99
Chains :  Asym./Biol. Unit :  A
Keywords :  Acetyltransferase, Bahd Superfamily, Trichothecene, Deoxynivalenol, T-2, Acetyl Coa, Fusarium, Tri101, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  G. S. Garvey, S. P. Mccormick, I. Rayment
Structural And Functional Characterization Of The Tri101 Trichothecene 3-O-Acetyltransferase From Fusarium Sporotrichioides And Fusarium Graminearum: Kinetic Insights To Combating Fusarium Head Blight
J. Biol. Chem. V. 283 1660 2008
PubMed-ID: 17923480  |  Reference-DOI: 10.1074/JBC.M705752200

(-) Compounds

Molecule 1 - TRICHOTHECENE 3-O-ACETYLTRANSFERASE
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET31B
    Expression System Strain: ROSETTA(DE3)
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: TRI101
    Organism Scientific: GIBBERELLA ZEAE
    Organism Taxid: 5518
    Strain: PH-1

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 16)

Asymmetric/Biological Unit (1, 16)
No.NameCountTypeFull Name
1MSE16Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 2RKT)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2RKT)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2RKT)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2RKT)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2RKT)

(-) Exons   (0, 0)

(no "Exon" information available for 2RKT)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:437
 aligned with O42692_GIBZA | O42692 from UniProtKB/TrEMBL  Length:451

    Alignment length:452
                             1                                                                                                                                                                                                                                                                                                                                                                                                                                                                  
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449  
         O42692_GIBZA     - -MAFKIQLDTLGQLPGLLSIYTQISLLYPVSDPSQYPTIVSTFEQGLKRFSEAVPWVAGQVKAEGISEGNTGTSFIVPFEDVPRVVVKDLRDDPSAPTIEGMRKAGYPMAMFDENIIAPRKTLPIGPGTGPDDPKPVILLQLNFIKGGLILTVNGQHGAMDMVGQDAVIRLLSKACRNDPFTEEEMTAMNLDRKTIVPYLENYTIGPEVDHQIVKPDVAGGDAVLTPVSASWAFFKFSPKAMSELKDAATKTLDASTKFVSTDDALSAFIWKSASRVRLERIDGSAPTEFCRAVDARPAMGVSNNYPGLLQNMTYHNSTIGEIANESLGATASRLRSELDPASMRQRTRGLATYLHNNPDKSNVSLTADADPSTSVMLSSWAKVGLWDYDFGFGLGKPETVRRPIFEPVESLMYFMPKKPDGEFCAALSLRDEDMDRLKADKEWTKYAQYVG 451
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------   ----------------------------------------------------------------------------------------------------------Transferase-2rktA01 A:125-444                                                                                                                                                                                                                                                                                                   ------- Pfam domains
         Sec.struct. author .....ee.hhhhhh..---.eeeeeeeee..hhhhhhhhhhhhhhhhhhhhhhhhhhhheeeeeeee..eeeeeeee.......eeeee........hhhhhhhh..hhhhhhhhhhh...................eeeeeeee..eeeeeeeee....hhhhhhhhhhhhhhhhh....hhhhhhhhhh..............hhhhh...........-----...eeeeeeeehhhhhhhhhhhhhhh.-----..hhhhhhhhhhhhhhhhhhh.......eeeeeeeeehhhhhh.........eeeeeeeeehhhhhhhhhhhhhhhhhh--hhhhhhhhhhhhhhhhhh..................eeeee....hhhhh..........eee.........eeee........eeeeeeeehhhhhhhhhhhhhhh..eeee Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2rkt A   0 SmAFKIQLDTLGQLPG---IYTQISLLYPVSDSSQYPTIVSTFEQGLKRFSEAVPWVAGQVKAEGISEGNTGTSFIVPFEDVPRVVVKDLRDDPSAPTIEGmRKAGYPmAmFDENIIAPRKTLPIGPGTGPDDPKPVILLQLNFIKGGLILTVNGQHGAmDmVGQDAVIRLLSKACRNDPFTEEEmTAmNLDRKTIVPYLENYTIGPEVDHQIVKADVAGG-----PVSASWAFFTFSPKAmSELKDAATKTL-----FVSTDDALSAFIWKSASRVRLERIDGSAPTEFCRAVDARPAmGVSNNYPGLLQNmTYHNSTIGEIANESLGATASRLRS--DPASmRQRTRGLATYLHNNPDKSNVSLTADADPSTSVmLSSWAKVGLWDYDFGLGLGKPETVRRPIFEPVESLmYFmPKKPDGEFCAALSLRDEDmDRLKADKEWTKYAQYVG 451
                             |       9     |  19        29        39        49        59        69        79        89        99 |     109|      119       129       139       149       159 |     169       179     | 189       199       209       219|     |229       239 |     249  |    259       269       279       289       299       309  |    319       329      |339   |   349       359       369      |379       389       399       409  |  | 419       429    |  439       449  
                             |            15  19                                                                               101-MSE  | |                                              159-MSE                   185-MSE                            220   226            241-MSE    252   258                                      299-MSE      312-MSE                 336  |   |                              376-MSE                             412-MSE               434-MSE             
                             1-MSE                                                                                                    108-MSE                                              161-MSE                    188-MSE                                                                                                                                                339   |                                                                     415-MSE                                
                                                                                                                                        110-MSE                                                                                                                                                                                                                                  343-MSE                                                                                                        


Chain A from PDB  Type:PROTEIN  Length:437
 aligned with Q9HDE2_GIBZA | Q9HDE2 from UniProtKB/TrEMBL  Length:444

    Alignment length:452
                             1                                                                                                                                                                                                                                                                                                                                                                                                                                                        444       
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439    |    -  
         Q9HDE2_GIBZA     - -MAFKIQLDTLGQLPGLLSIYTQISLLYPVSDSSQYPTIVSTFEQGLKRFSEAVPWVAGQVKAEGISEGNTGTSFIVPFEDVPRVVVKDLRDDPSAPTIEGMRKAGYPMAMFDENIIAPRKTLPIGPGTGPDDPKPVILLQLNFIKGGLILTVNGQHGAMDMVGQDAVIRLLSKACRNDPFTEEEMTAMNLDRKTIVPYLENYTIGPEVDHQIVKADVAGGDAVLTPVSASWAFFTFSPKAMSELKDAATKTLDASTKFVSTDDALSAFIWKSASRVRLERIDGSAPTEFCRAVDARPAMGVSNNYPGLLQNMTYHNSTIGEIANESLGATASRLRSELDPASMRQRTRGLATYLHNNPDKSNVSLTADADPSTSVMLSSWAKVGLWDYDFGLGLGKPETVRRPIFEPVESLMYFMPKKPDGEFCAALSLRDEDMDRLKADKEWT-------   -
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------   ----------------------------------------------------------------------------------------------------------Transferase-2rktA01 A:125-444                                                                                                                                                                                                                                                                                                   ------- Pfam domains
         Sec.struct. author .....ee.hhhhhh..---.eeeeeeeee..hhhhhhhhhhhhhhhhhhhhhhhhhhhheeeeeeee..eeeeeeee.......eeeee........hhhhhhhh..hhhhhhhhhhh...................eeeeeeee..eeeeeeeee....hhhhhhhhhhhhhhhhh....hhhhhhhhhh..............hhhhh...........-----...eeeeeeeehhhhhhhhhhhhhhh.-----..hhhhhhhhhhhhhhhhhhh.......eeeeeeeeehhhhhh.........eeeeeeeeehhhhhhhhhhhhhhhhhh--hhhhhhhhhhhhhhhhhh..................eeeee....hhhhh..........eee.........eeee........eeeeeeeehhhhhhhhhhhhhhh..eeee Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2rkt A   0 SmAFKIQLDTLGQLPG---IYTQISLLYPVSDSSQYPTIVSTFEQGLKRFSEAVPWVAGQVKAEGISEGNTGTSFIVPFEDVPRVVVKDLRDDPSAPTIEGmRKAGYPmAmFDENIIAPRKTLPIGPGTGPDDPKPVILLQLNFIKGGLILTVNGQHGAmDmVGQDAVIRLLSKACRNDPFTEEEmTAmNLDRKTIVPYLENYTIGPEVDHQIVKADVAGG-----PVSASWAFFTFSPKAmSELKDAATKTL-----FVSTDDALSAFIWKSASRVRLERIDGSAPTEFCRAVDARPAmGVSNNYPGLLQNmTYHNSTIGEIANESLGATASRLRS--DPASmRQRTRGLATYLHNNPDKSNVSLTADADPSTSVmLSSWAKVGLWDYDFGLGLGKPETVRRPIFEPVESLmYFmPKKPDGEFCAALSLRDEDmDRLKADKEWTKYAQYVG 451
                             |       9     |  19        29        39        49        59        69        79        89        99 |     109|      119       129       139       149       159 |     169       179     | 189       199       209       219|     |229       239 |     249  |    259       269       279       289       299       309  |    319       329      |339   |   349       359       369      |379       389       399       409  |  | 419       429    |  439       449  
                             1-MSE        15  19                                                                               101-MSE  | |                                              159-MSE                   185-MSE                            220   226            241-MSE    252   258                                      299-MSE      312-MSE                 336  |   |                              376-MSE                             412-MSE               434-MSE             
                                                                                                                                      108-MSE                                              161-MSE                    188-MSE                                                                                                                                                339   |                                                                     415-MSE                                
                                                                                                                                        110-MSE                                                                                                                                                                                                                                  343-MSE
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2RKT)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2RKT)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Clan: CoA-acyltrans (22)

(-) Gene Ontology  (2, 4)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (Q9HDE2_GIBZA | Q9HDE2)
molecular function
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0016747    transferase activity, transferring acyl groups other than amino-acyl groups    Catalysis of the transfer of an acyl group, other than amino-acyl, from one compound (donor) to another (acceptor).

Chain A   (O42692_GIBZA | O42692)
molecular function
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0016747    transferase activity, transferring acyl groups other than amino-acyl groups    Catalysis of the transfer of an acyl group, other than amino-acyl, from one compound (donor) to another (acceptor).

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 2rkt)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2rkt)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2rkt
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  O42692_GIBZA | O42692
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
  Q9HDE2_GIBZA | Q9HDE2
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  O42692_GIBZA | O42692
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Q9HDE2_GIBZA | Q9HDE2
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        Q9HDE2_GIBZA | Q9HDE2: 2rkv 3b2s 3b30
UniProtKB/TrEMBL
        O42692_GIBZA | O42692: 2rkv 3b2s 3b30

(-) Related Entries Specified in the PDB File

2rkv 2zba 3b2s 3b30