Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  RBD OF RAL GUANOSINE-NUCLEOTIDE EXCHANGE FACTOR (PROTEIN), NMR, 10 STRUCTURES
 
Authors :  M. Geyer, C. Herrmann, A. Wittinghofer, H. R. Kalbitzer
Date :  13 Feb 97  (Deposition) - 04 Mar 98  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (10x)
Keywords :  Ras-Binding Domain, Ralgef, Ralgds, Ras, Rbd (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  M. Geyer, C. Herrmann, S. Wohlgemuth, A. Wittinghofer, H. R. Kalbitzer
Structure Of The Ras-Binding Domain Of Ralgef And Implications For Ras Binding And Signalling.
Nat. Struct. Biol. V. 4 694 1997
PubMed-ID: 9302994  |  Reference-DOI: 10.1038/NSB0997-694
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - RALGEF-RBD
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21
    Expression System Gene: HUMAN RALGEF GENE (RALGDS)
    Expression System Plasmid: PGEX-4T3
    Expression System Strain: BL21
    Expression System Taxid: 511693
    Gene: HUMAN RALGEF GENE (RALGDS)
    Organism Common: HUMAN
    Organism Scientific: HOMO SAPIENS
    Organism Taxid: 9606

 Structural Features

(-) Chains, Units

  
NMR Structure (10x): 

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2RGF)

(-) Sites  (0, 0)

(no "Site" information available for 2RGF)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2RGF)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2RGF)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2RGF)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1RAPS50200 Ras-associating (RA) domain profile.GNDS_HUMAN798-885  1A:11-97

(-) Exons   (3, 3)

NMR Structure (3, 3)
 ENSEMBLUniProtKBPDB
No.Transcript IDExonExon IDGenome LocationLengthIDLocationLengthCountLocationLength
1.3bENST000003720503bENSE00001514306chr9:135996563-135996359205GNDS_HUMAN1-61610--
1.4ENST000003720504ENSE00001801549chr9:135987539-135987429111GNDS_HUMAN62-98370--
1.5ENST000003720505ENSE00001694768chr9:135985876-135985683194GNDS_HUMAN99-163650--
1.6aENST000003720506aENSE00001804795chr9:135985108-13598501396GNDS_HUMAN163-195330--
1.7aENST000003720507aENSE00001736419chr9:135984253-135984060194GNDS_HUMAN195-260660--
1.8aENST000003720508aENSE00001137115chr9:135983793-135983375419GNDS_HUMAN260-3991400--
1.9ENST000003720509ENSE00001137109chr9:135982687-135982472216GNDS_HUMAN400-471720--
1.10ENST0000037205010ENSE00001137104chr9:135982135-135982032104GNDS_HUMAN472-506350--
1.11ENST0000037205011ENSE00001137096chr9:135981403-13598131985GNDS_HUMAN506-534290--
1.12cENST0000037205012cENSE00001137089chr9:135979718-13597965069GNDS_HUMAN535-557230--
1.13bENST0000037205013bENSE00001137082chr9:135979220-13597913487GNDS_HUMAN558-586290--
1.14ENST0000037205014ENSE00000954148chr9:135978649-13597861733GNDS_HUMAN587-597110--
1.15ENST0000037205015ENSE00001137069chr9:135978287-135978166122GNDS_HUMAN598-638410--
1.16bENST0000037205016bENSE00001137061chr9:135977958-13597786396GNDS_HUMAN638-670330--
1.17aENST0000037205017aENSE00001137012chr9:135977526-135977325202GNDS_HUMAN670-737680--
1.17fENST0000037205017fENSE00002187251chr9:135977149-135976907243GNDS_HUMAN738-818811A:1-3131
1.17kENST0000037205017kENSE00001720993chr9:135975769-135975655115GNDS_HUMAN819-857391A:32-7039
1.17oENST0000037205017oENSE00001677413chr9:135974149-1359731071043GNDS_HUMAN857-914581A:70-9728

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:97
 aligned with GNDS_HUMAN | Q12967 from UniProtKB/Swiss-Prot  Length:914

    Alignment length:97
                                   797       807       817       827       837       847       857       867       877       
           GNDS_HUMAN   788 ALPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEEEEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRT 884
               SCOP domains d2rgfa_ A: Ral guanosine-nucleotide exchange factor, RalGDS                                       SCOP domains
               CATH domains 2rgfA00 A:1-97 Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1                 CATH domains
               Pfam domains ----------RA-2rgfA01 A:11-97                                                                      Pfam domains
         Sec.struct. author ...........eeeeeeee........eeeeee....hhhhhhhhhhh..........eeeeee.....eeee......hhhh......eeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------RA  PDB: A:11-97 UniProt: 798-885                                                       PROSITE
           Transcript 1 (1) Exon 1.17f  PDB: A:1-31        Exon 1.17k  PDB: A:32-70               --------------------------- Transcript 1 (1)
           Transcript 1 (2) ---------------------------------------------------------------------Exon 1.17o  PDB: A:70-97     Transcript 1 (2)
                 2rgf A   1 ALPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEEEEPEDYELLQILSDDRKLKIPENANVFYAMNSTANYDFVLKKRT  97
                                    10        20        30        40        50        60        70        80        90
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure
(-)
Class: Alpha and beta proteins (a+b) (23004)

(-) CATH Domains  (1, 1)

NMR Structure
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 1)

NMR Structure
(-)
Clan: Ubiquitin (279)

(-) Gene Ontology  (11, 11)

NMR Structure(hide GO term definitions)
Chain A   (GNDS_HUMAN | Q12967)
molecular function
    GO:0030695    GTPase regulator activity    Modulates the rate of GTP hydrolysis by a GTPase.
    GO:0005085    guanyl-nucleotide exchange factor activity    Stimulates the exchange of guanyl nucleotides associated with a GTPase. Under normal cellular physiological conditions, the concentration of GTP is higher than that of GDP, favoring the replacement of GDP by GTP in association with the GTPase.
    GO:0005515    protein binding    Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
    GO:0007265    Ras protein signal transduction    A series of molecular signals within the cell that are mediated by a member of the Ras superfamily of proteins switching to a GTP-bound active state.
    GO:0043547    positive regulation of GTPase activity    Any process that activates or increases the activity of a GTPase.
    GO:0050790    regulation of catalytic activity    Any process that modulates the activity of an enzyme.
    GO:0007165    signal transduction    The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
    GO:0007264    small GTPase mediated signal transduction    Any series of molecular signals in which a small monomeric GTPase relays one or more of the signals.
cellular component
    GO:0005903    brush border    The dense covering of microvilli on the apical surface of a epithelial cells in tissues such as the intestine, kidney, and choroid plexus; the microvilli aid absorption by increasing the surface area of the cell.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
    GO:0005634    nucleus    A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2rgf)
 
  Sites
(no "Sites" information available for 2rgf)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2rgf)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ NMR Structure - model 1 PNG format | NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2rgf
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GNDS_HUMAN | Q12967
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  GNDS_HUMAN | Q12967
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GNDS_HUMAN | Q12967: 1rax 2b3a 3kh0

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2RGF)