|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 5)| Asymmetric Unit (3, 5) Biological Unit 1 (3, 10) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2RA5) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2RA5) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2RA5) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2RA5) |
Exons (0, 0)| (no "Exon" information available for 2RA5) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:150 aligned with Q9RKT6_STRCO | Q9RKT6 from UniProtKB/TrEMBL Length:245 Alignment length:180 75 85 95 105 115 125 135 145 155 165 175 185 195 205 215 225 235 245 Q9RKT6_STRCO 66 GLLVRRRGVGTQVVHSKVRRPLELSSLYDDLEAAGQRPATKVLVNTVVPATAEIAAALGVAEDSEVHRIERLRLTHGEPMAYLCNYLPPGLVDLDTGQLEATGLYRLMRAAGITLHSARQSIGARAATSGEAERLGEDAGAPLLTMERTTFDDTGRAVEFGTHTYRPSRYSFEFQLLVRP 245 SCOP domains d2ra5a1 A:66-245 Putative transcriptional regulator SCO6256 SCOP domains CATH domains ------2 ra5A01 A:72-231 Chorismate lyase -------------- CATH domains Pfam domains GntR-2r------------------------------UTRA-2ra5A01 A:103-236 --------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 2ra5 A 66 GLLVRRR------------------------------PATKVLVNTVVPATAEIAAALGVAEDSEVHRIERLRLTHGEPmAYLCNYLPPGLVDLDTGQLEATGLYRLmRAAGITLHSARQSIGARAATSGEAERLGEDAGAPLLTmERTTFDDTGRAVEFGTHTYRPSRYSFEFQLLVRP 245 | - - - 105 115 125 135 145 155 165 175 185 195 205 | 215 225 235 245 72 103 145-MSE 173-MSE 211-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (2, 2)| Asymmetric Unit |
Gene Ontology (4, 4)|
Asymmetric Unit(hide GO term definitions) Chain A (Q9RKT6_STRCO | Q9RKT6)
|
||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|