Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF PHOSPHATIDYLETHANOLAMINE-BINDING PROTEIN, PFL0955C, FROM PLASMODIUM FALCIPARUM
 
Authors :  A. K. Wernimont, J. Lew, I. Kozieradzki, Y. H. Lin, X. Sun, C. Khuu, L. Cro Y. Zhao, M. Schapira, C. H. Arrowsmith, A. M. Edwards, J. Weigelt, M. Su A. Bochkarev, R. Hui, J. D. Artz, T. Xiao, Structural Genomics Conso (Sgc)
Date :  07 Sep 07  (Deposition) - 25 Sep 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.65
Chains :  Asym./Biol. Unit :  A
Keywords :  Plasmodium Falciparum Malaria Lipid Phosphatidylethanolamine, Structural Genomics, Structural Genomics Consortium, Sgc, Lipid Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  A. K. Wernimont, J. Lew, I. Kozieradzki, Y. H. Lin, X. Sun, C. Khuu, L. Crombette, Y. Zhao, M. Schapira, C. H. Arrowsmith, A. M. Edwards, J. Weigelt, M. Sundstrom, A. Bochkarev, R. Hui, J. D. Artz, T. Xiao
Crystal Structure Of Phosphatidylethanolamine-Binding Protein, Pfl0955C, From Plasmodium Falciparum.
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PHOSPHATIDYLETHANOLAMINE-BINDING PROTEIN, PUTATIVE
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidP15-MHL
    Expression System StrainDH5A
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GenePFL0955C
    Organism ScientificPLASMODIUM FALCIPARUM
    Organism Taxid36329
    Strain3D7

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2R77)

(-) Sites  (0, 0)

(no "Site" information available for 2R77)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2R77)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Ile A:31 -Pro A:32
2Tyr A:95 -Pro A:96

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2R77)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2R77)

(-) Exons   (0, 0)

(no "Exon" information available for 2R77)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:190
 aligned with Q7KQK1_PLAF7 | Q7KQK1 from UniProtKB/TrEMBL  Length:190

    Alignment length:191
                              1                                                                                                                                                                                            
                              |      8        18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188 
         Q7KQK1_PLAF7     - --MTIPTISELKKDRIIPHVFPNDKIDLNVDLFISFKAGKEVNHGNVLDIAGTGSVPRNIKFSEEPPDGYCFVLFMVDPDYPSRLRPDGKEYIHWVVSGIKTKELIKGTQKNCVTILPYVGPSIKKGTGLHRISFIISLIKEEDKDNITGLPHYKGEKYITRVKFNNYESVHNIAQINNMKIVGYNWCQIE 189
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------PBP-2r77A01 A:43-191                                                                                                                                 -------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhh...........eeeeee..ee.......hhhhh.....eeee.......eeeeeeeeeeee........eeeeeeeeeee...eee.......eeee................eeeeeeee.hhh.........-..............hhhhhhhhh...eeeeee.... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2r77 A  15 YFQGIPTISELKKDRIIPHVFPNDKIDLNVDLFISFKAGKEVNHGNVLDIAGTGSVPRNIKFSEEPPDGYCFVLFMVDPDYPSRLRPDGKEYIHWVVSGIKTKELIKGTQKNCVTILPYVGPSIKKGTGLHRISFIISLIKEEDKDNITGLPHY-GEKYITRVKFNNYESVHNIAQINNMKIVGYNWCQIE 205
                                    24        34        44        54        64        74        84        94       104       114       124       134       144       154       164   | | 174       184       194       204 
                                                                                                                                                                                   168 |                                   
                                                                                                                                                                                     170                                   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2R77)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2R77)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit

(-) Gene Ontology  (3, 3)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (Q7KQK1_PLAF7 | Q7KQK1)
molecular function
    GO:0008429    phosphatidylethanolamine binding    Interacting selectively and non-covalently with phosphatidylethanolamine, any of a class of glycerophospholipids in which a phosphatidyl group is esterified to the hydroxyl group of ethanolamine.
    GO:0019887    protein kinase regulator activity    Modulates the activity of a protein kinase, an enzyme which phosphorylates a protein.
biological process
    GO:0045859    regulation of protein kinase activity    Any process that modulates the frequency, rate or extent of protein kinase activity.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2r77)
 
  Sites
(no "Sites" information available for 2r77)
 
  Cis Peptide Bonds
    Ile A:31 - Pro A:32   [ RasMol ]  
    Tyr A:95 - Pro A:96   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2r77
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q7KQK1_PLAF7 | Q7KQK1
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q7KQK1_PLAF7 | Q7KQK1
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2R77)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2R77)