|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 11)| Asymmetric/Biological Unit (3, 11) |
Sites (0, 0)| (no "Site" information available for 2R74) |
SS Bonds (2, 2)
Asymmetric/Biological Unit
|
||||||||||||
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2R74) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2R74) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2R74) |
Exons (0, 0)| (no "Exon" information available for 2R74) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:142 aligned with TRIC_TRIVU | Q29147 from UniProtKB/Swiss-Prot Length:180 Alignment length:143 47 57 67 77 87 97 107 117 127 137 147 157 167 177 TRIC_TRIVU 38 LSRHWHTVVLASSDRSLIEEEGPFRNFIQNITVESGNLNGFFLTRKNGQCIPLYLTAFKTEEARQFKLNYYGTNDVYYGSSKPNEYAKFIFYNYHDGKVNVVANLFGRTPNLSNEIKKRFEEDFMNRGFRRENILDISEVDHC 180 SCOP domains d 2r74a_ A: automated matches SCOP domains CATH domains 2 r74A00 A:24-166 [code=2.40.128.20, no name defined] CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2r74 A 24 L-RHWHTVVLASSDRSLIEEEGPFRNFIQNITVESGNLNGFFLTRKNGQCIPLYLTAFKTEEARQFKLNYYGTNDVYYESSKPNEYAKFIFYNYHDGKVNVVANLFGRTPNLSNEIKKRFEEDFMNRGFRRENILDISEVDHC 166 | | 33 43 53 63 73 83 93 103 113 123 133 143 153 163 | | 24 | 26 Chain B from PDB Type:PROTEIN Length:142 aligned with TRIC_TRIVU | Q29147 from UniProtKB/Swiss-Prot Length:180 Alignment length:143 47 57 67 77 87 97 107 117 127 137 147 157 167 177 TRIC_TRIVU 38 LSRHWHTVVLASSDRSLIEEEGPFRNFIQNITVESGNLNGFFLTRKNGQCIPLYLTAFKTEEARQFKLNYYGTNDVYYGSSKPNEYAKFIFYNYHDGKVNVVANLFGRTPNLSNEIKKRFEEDFMNRGFRRENILDISEVDHC 180 SCOP domains d 2r74b_ B: automated matches SCOP domains CATH domains 2 r74B00 B:24-166 [code=2.40.128.20, no name defined] CATH domains Pfam domains (1) --Lipocalin-2r74B01 B:26-164 -- Pfam domains (1) Pfam domains (2) --Lipocalin-2r74B02 B:26-164 -- Pfam domains (2) SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2r74 B 24 L-RHWHTVVLASSDRSLIEEEGPFRNFIQNITVESGNLNGFFLTRKNGQCIPLYLTAFKTEEARQFKLNYYGTNDVYYESSKPNEYAKFIFYNYHDGKVNVVANLFGRTPNLSNEIKKRFEEDFMNRGFRRENILDISEVDHC 166 | | 33 43 53 63 73 83 93 103 113 123 133 143 153 163 24 | 26
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric/Biological Unit
|
CATH Domains (1, 2)| Asymmetric/Biological Unit |
Pfam Domains (1, 2)
Asymmetric/Biological Unit
|
Gene Ontology (4, 4)|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (TRIC_TRIVU | Q29147)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|