2R55 - JenaLib

Asymmetric Unit (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   HUMAN STAR-RELATED LIPID TRANSFER PROTEIN 5

Authors :   L. Lehtio, R. D. Busam, C. H. Arrowsmith, H. Berglund, R. Collins, L. G. D A. M. Edwards, S. Flodin, A. Flores, S. Graslund, M. Hammarstrom, B. M. M. D. Herman, I. Johansson, A. Kallas, T. Karlberg, T. Kotenyova, M. Mo P. Nordlund, T. Nyman, J. Sagemark, M. Sundstrom, A. G. Thorsell, L. Tr S. Van Den Berg, J. Weigelt, M. Welin, C. Persson, Structural Genom Consortium (Sgc)

Date :   03 Sep 07 (Deposition) - 18 Sep 07 (Release) - 21 Sep 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.50

Chains :   Asym. Unit : A,B
Biol. Unit 1: A  (1x)
Biol. Unit 2: B  (1x)

Keywords :   Alpha And Beta Protein, Cholesterol Binding, Structural Genomics, Structural Genomics Consortium, Sgc, Lipid Transport, Lipid-Binding, Transport, Transport Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. G. Thorsell, W. H. Lee, C. Persson, M. I. Siponen, M. Nilsson, R. D. Busam, T. Kotenyova, H. Schuler, L. Lehtio
Comparative Structural Analysis Of Lipid Binding Start Domains.
Plos One V. 6 19521 2011
PubMed-ID: 21738568 | Reference-DOI: 10.1371/JOURNAL.PONE.0019521

Molecule 1 - STAR-RELATED LIPID TRANSFER PROTEIN 5
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PNIC-BSA4
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Gene	:	STARD5
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	STARD5, START DOMAIN-CONTAINING PROTEIN 5

		1	2
Asymmetric Unit	:	A	B
Biological Unit 1 (1x)	:	A
Biological Unit 2 (1x)	:		B

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2R55)

(no "Site" information available for 2R55)

(no "SS Bond" information available for 2R55)

(no "Cis Peptide Bond" information available for 2R55)

Asymmetric Unit (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_052071	G	74	S	STAR5_HUMAN	Polymorphism	4384572	A/B	G	74	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_052071	G	74	S	STAR5_HUMAN	Polymorphism	4384572	A	G	74	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_052071	G	74	S	STAR5_HUMAN	Polymorphism	4384572	B	G	74	S

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (1, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	START	PS50848	START domain profile.	STAR5_HUMAN	11-213	2	A:11-213 B:11-213

Biological Unit 1 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	START	PS50848	START domain profile.	STAR5_HUMAN	11-213	1	A:11-213 -

Biological Unit 2 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	START	PS50848	START domain profile.	STAR5_HUMAN	11-213	1	- B:11-213

Asymmetric Unit (6, 12)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1b	ENST00000302824	1b	ENSE00001891841	chr15:81616482-81616342	141	STAR5_HUMAN	1-33	33	2	A:2-33 B:2-33	32 32
1.2	ENST00000302824	2	ENSE00001247712	chr15:81615289-81615240	50	STAR5_HUMAN	34-50	17	2	A:34-50 B:34-50	17 17
1.3	ENST00000302824	3	ENSE00001637385	chr15:81614881-81614749	133	STAR5_HUMAN	50-94	45	2	A:50-94 (gaps) B:50-94 (gaps)	45 45
1.4	ENST00000302824	4	ENSE00001743829	chr15:81611797-81611680	118	STAR5_HUMAN	95-134	40	2	A:95-134 B:95-134	40 40
1.5	ENST00000302824	5	ENSE00001673598	chr15:81610843-81610750	94	STAR5_HUMAN	134-165	32	2	A:134-164 B:134-164	31 31
1.6b	ENST00000302824	6b	ENSE00001716823	chr15:81605744-81601394	4351	STAR5_HUMAN	165-213	49	2	A:167-213 B:167-213	47 47

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:208
 aligned with STAR5_HUMAN | Q9NSY2 from UniProtKB/Swiss-Prot  Length:213

    Alignment length:212
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211  
          STAR5_HUMAN     2 DPALAAQMSEAVAEKMLQYRRDTAGWKICREGNGVSVSWRPSVEFPGNLYRGEGIVYGTLEEVWDCVKPAVGGLRVKWDENVTGFEIIQSITDTLCVSRTSTPSAAMKLISPRDFVDLVLVKRYEDGTISSNATHVEHPLCPPKPGFVRGFNHPCGCFCEPLPGEPTKTNLVTFFHTDLSGYLPQNVVDSFFPRSMTRFYANLQKAVKQFHE 213
               SCOP domains d2r55a_ A: automated matches                                                                                                                                                                                         SCOP domains
               CATH domains 2r55A00 A:2-213  [code=3.30.530.20, no name defined]                                                                                                                                                                 CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhh....eeee....eeeeeee......eeeeeeeee..hhhhhhhhhh.--..hhhhhh....eeeeeee....eeeeeee...........eeeeeeeeeee.....eeeeeee............eeeee..eeeeeee..--...eeeeeee.ee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------S------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------START  PDB: A:11-213 UniProt: 11-213                                                                                                                                                                        PROSITE
           Transcript 1 (1) Exon 1.1b  PDB: A:2-33          Exon 1.2         --------------------------------------------Exon 1.4  PDB: A:95-134 UniProt: 95-134 ------------------------------Exon 1.6b  PDB: A:167-213 UniProt: 165-213        Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------Exon 1.3  PDB: A:50-94 (gaps) UniProt: 50-94 ---------------------------------------Exon 1.5  PDB: A:134-164        ------------------------------------------------ Transcript 1 (2)
                 2r55 A   2 FQSMAAQMSEAVAEKMLQYRRDTAGWKICREGNGVSVSWRPSVEFPGNLYRGEGIVYGTLEEVWDCVKP--GGLRVKWDENVTGFEIIQSITDTLCVSRTSTPSAAMKLISPRDFVDLVLVKRYEDGTISSNATHVEHPLCPPKPGFVRGFNHPCGCFCEPLP--PTKTNLVTFFHTDLSGYLPQNVVDSFFPRSMTRFYANLQKAVKQFHE 213
                                    11        21        31        41        51        61        |- |      81        91       101       111       121       131       141       151       161  |  | 171       181       191       201       211  
                                                                                               70 73                                                                                        164  |                                              
                                                                                                                                                                                               167

Chain B from PDB  Type:PROTEIN  Length:208
 aligned with STAR5_HUMAN | Q9NSY2 from UniProtKB/Swiss-Prot  Length:213

    Alignment length:212
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211  
          STAR5_HUMAN     2 DPALAAQMSEAVAEKMLQYRRDTAGWKICREGNGVSVSWRPSVEFPGNLYRGEGIVYGTLEEVWDCVKPAVGGLRVKWDENVTGFEIIQSITDTLCVSRTSTPSAAMKLISPRDFVDLVLVKRYEDGTISSNATHVEHPLCPPKPGFVRGFNHPCGCFCEPLPGEPTKTNLVTFFHTDLSGYLPQNVVDSFFPRSMTRFYANLQKAVKQFHE 213
               SCOP domains d2r55b_ B: automated matches                                                                                                                                                                                         SCOP domains
               CATH domains 2r55B00 B:2-213  [code=3.30.530.20, no name defined]                                                                                                                                                                 CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhhhhhhhhh....eeee....eeeeeee......eeeeeeeee..hhhhhhhhhh.--..hhhhhh....eeeeee.....eeeeeee...........eeeeeeeeeee.....eeeeeee............ee.ee..eeeeeee..--...eeeeeee.ee.....hhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------S------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------START  PDB: B:11-213 UniProt: 11-213                                                                                                                                                                        PROSITE
           Transcript 1 (1) Exon 1.1b  PDB: B:2-33          Exon 1.2         --------------------------------------------Exon 1.4  PDB: B:95-134 UniProt: 95-134 ------------------------------Exon 1.6b  PDB: B:167-213 UniProt: 165-213        Transcript 1 (1)
           Transcript 1 (2) ------------------------------------------------Exon 1.3  PDB: B:50-94 (gaps) UniProt: 50-94 ---------------------------------------Exon 1.5  PDB: B:134-164        ------------------------------------------------ Transcript 1 (2)
                 2r55 B   2 FQSMAAQMSEAVAEKMLQYRRDTAGWKICREGNGVSVSWRPSVEFPGNLYRGEGIVYGTLEEVWDCVKP--GGLRVKWDENVTGFEIIQSITDTLCVSRTSTPSAAMKLISPRDFVDLVLVKRYEDGTISSNATHVEHPLCPPKPGFVRGFNHPCGCFCEPLP--PTKTNLVTFFHTDLSGYLPQNVVDSFFPRSMTRFYANLQKAVKQFHE 213
                                    11        21        31        41        51        61        |- |      81        91       101       111       121       131       141       151       161  |  | 171       181       191       201       211  
                                                                                               70 73                                                                                        164  |                                              
                                                                                                                                                                                               167

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: TBP-like (289)

Superfamily: Bet v1-like (158)

Family: automated matches (39)

Protein domain: automated matches (39)

Human (Homo sapiens) [TaxId: 9606] (1)

1a	d2r55a_	A:
1b	d2r55b_	B:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4 (47)

Homologous Superfamily: [code=3.30.530.20, no name defined] (47)

Human (Homo sapiens) (6)

1a	2r55A00	A:2-213
1b	2r55B00	B:2-213

(no "Pfam Domain" information available for 2R55)

Asymmetric Unit(hide GO term definitions)

Chain A,B (STAR5_HUMAN | Q9NSY2)

molecular function
	GO:0032052	bile acid binding	Interacting selectively and non-covalently with bile acids, any of a group of steroid carboxylic acids occurring in bile.
	GO:0008289	lipid binding	Interacting selectively and non-covalently with a lipid.
biological process
	GO:0006700	C21-steroid hormone biosynthetic process	The chemical reactions and pathways resulting in the formation of C21-steroid hormones, steroid compounds containing 21 carbons which function as hormones.
	GO:0006869	lipid transport	The directed movement of lipids into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. Lipids are compounds soluble in an organic solvent but not, or sparingly, in an aqueous solvent.
	GO:0006810	transport	The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2r55)

	Sites
(no "Sites" information available for 2r55)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2r55)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2r55
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	STAR5_HUMAN \| Q9NSY2
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	STAR5_HUMAN \| Q9NSY2
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

(no "Entries Sharing at Least One Protein Chain" available for 2R55)

(no "Related Entries Specified in the PDB File" available for 2R55)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 2)

PROSITE Motifs (1, 2)

Exons (6, 12)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (0, 0)

Gene Ontology (6, 6)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File