Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF MELAMPSORA LINI AVIRULENCE PROTEIN, AVRL567-D
 
Authors :  G. Guncar, C. I. Wang, J. K. Forwood, T. Teh, A. M. Catanzariti, G. Lawrence, H. J. Schirra, P. A. Anderson, J. G. Ellis, P. N. Dodds, B. Kobe
Date :  08 Aug 07  (Deposition) - 30 Oct 07  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.26
Chains :  Asym./Biol. Unit :  A
Keywords :  Avrl567-A, Avrl567-D, Crystallization, Molecular Replacement, Plant Disease Resistance, , Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  C. I. Wang, G. Guncar, J. K. Forwood, T. Teh, A. M. Catanzariti, G. J. Lawrence, F. E. Loughlin, J. P. Mackay, H. J. Schirra, P. A. Anderson, J. G. Ellis, P. N. Dodds, B. Kobe
Crystal Structures Of Flax Rust Avirulence Proteins Avrl567-A And -D Reveal Details Of The Structural Basis For Flax Disease Resistance Specificity.
Plant Cell V. 19 2898 2007
PubMed-ID: 17873095  |  Reference-DOI: 10.1105/TPC.107.053611
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - AVRL567-D
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI BL21(DE3)
    Expression System Plasmid: PHUE
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Organism Common: FLAX RUST
    Organism Scientific: MELAMPSORA LINI
    Organism Taxid: 5261
    Strain: BS1

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2QVT)

(-) Sites  (0, 0)

(no "Site" information available for 2QVT)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2QVT)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2QVT)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2QVT)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2QVT)

(-) Exons   (0, 0)

(no "Exon" information available for 2QVT)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:113
 aligned with Q1HBK6_MELLI | Q1HBK6 from UniProtKB/TrEMBL  Length:150

    Alignment length:113
                                    46        56        66        76        86        96       106       116       126       136       146   
         Q1HBK6_MELLI    37 GYTRFYRSPTASVTLSGLVNVKWDNEQMTMPLFKWIGGEQAEELHFCVHIAHSIGPKLNLARTLGTVNSNMDQHWAQAHRHSGATRRTIQDFHLFANDIPNFPDYIKIKLVPK 149
               SCOP domains ----------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains AvrL567-A-2qvtA01 A:37-149                                                                                        Pfam domains
         Sec.struct. author ..eeee.....eeee...eeeee.......eeeee.........eeeeee...........eeeeeee.....................hhhhh..........eeeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------- Transcript
                 2qvt A  37 GYTRFYRSPTASVTLSGLVNVKWDNEQMTMPLFKWIGGEQAEELHFCVHIAHSIGPKLNLARTLGTVNSNMDQHWAQAHRHSGATRRTIQDFHLFANDIPNFPDYIKIKLVPK 149
                                    46        56        66        76        86        96       106       116       126       136       146
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2QVT)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2QVT)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Clan: no clan defined [family: AvrL567-A] (2)

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 2QVT)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2qvt)
 
  Sites
(no "Sites" information available for 2qvt)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2qvt)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2qvt
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q1HBK6_MELLI | Q1HBK6
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q1HBK6_MELLI | Q1HBK6
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2QVT)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2QVT)