Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF MELAMPSORA LINI AVIRULENCE PROTEIN, AVRL567-D
 
Authors :  G. Guncar, C. I. Wang, J. K. Forwood, T. Teh, A. M. Catanzariti, G. Lawrence, H. J. Schirra, P. A. Anderson, J. G. Ellis, P. N. Dodds, B. Kobe
Date :  08 Aug 07  (Deposition) - 30 Oct 07  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.26
Chains :  Asym./Biol. Unit :  A
Keywords :  Avrl567-A, Avrl567-D, Crystallization, Molecular Replacement, Plant Disease Resistance, , Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. I. Wang, G. Guncar, J. K. Forwood, T. Teh, A. M. Catanzariti, G. J. Lawrence, F. E. Loughlin, J. P. Mackay, H. J. Schirra, P. A. Anderson, J. G. Ellis, P. N. Dodds, B. Kobe
Crystal Structures Of Flax Rust Avirulence Proteins Avrl567-A And -D Reveal Details Of The Structural Basis For Flax Disease Resistance Specificity.
Plant Cell V. 19 2898 2007
PubMed-ID: 17873095  |  Reference-DOI: 10.1105/TPC.107.053611
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - AVRL567-D
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPHUE
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    Organism CommonFLAX RUST
    Organism ScientificMELAMPSORA LINI
    Organism Taxid5261
    StrainBS1

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2QVT)

(-) Sites  (0, 0)

(no "Site" information available for 2QVT)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2QVT)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2QVT)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2QVT)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2QVT)

(-) Exons   (0, 0)

(no "Exon" information available for 2QVT)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:113
 aligned with Q1HBK6_MELLI | Q1HBK6 from UniProtKB/TrEMBL  Length:150

    Alignment length:113
                                    46        56        66        76        86        96       106       116       126       136       146   
         Q1HBK6_MELLI    37 GYTRFYRSPTASVTLSGLVNVKWDNEQMTMPLFKWIGGEQAEELHFCVHIAHSIGPKLNLARTLGTVNSNMDQHWAQAHRHSGATRRTIQDFHLFANDIPNFPDYIKIKLVPK 149
               SCOP domains ----------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains AvrL567-A-2qvtA01 A:37-149                                                                                        Pfam domains
         Sec.struct. author ..eeee.....eeee...eeeee.......eeeee.........eeeeee...........eeeeeee.....................hhhhh..........eeeeeeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------- Transcript
                 2qvt A  37 GYTRFYRSPTASVTLSGLVNVKWDNEQMTMPLFKWIGGEQAEELHFCVHIAHSIGPKLNLARTLGTVNSNMDQHWAQAHRHSGATRRTIQDFHLFANDIPNFPDYIKIKLVPK 149
                                    46        56        66        76        86        96       106       116       126       136       146   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2QVT)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2QVT)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit

(-) Gene Ontology  (0, 0)

Asymmetric/Biological Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 2QVT)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2qvt)
 
  Sites
(no "Sites" information available for 2qvt)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2qvt)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2qvt
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q1HBK6_MELLI | Q1HBK6
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q1HBK6_MELLI | Q1HBK6
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2QVT)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2QVT)