|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2QUP) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2QUP) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2QUP) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2QUP) |
Exons (0, 0)| (no "Exon" information available for 2QUP) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:119 aligned with Q9KCU1_BACHD | Q9KCU1 from UniProtKB/TrEMBL Length:145 Alignment length:122 33 43 53 63 73 83 93 103 113 123 133 143 Q9KCU1_BACHD 24 GVSFSEVMGKQRDEKAYERLQALMSKIDDQGKLLSETRTIEELRKYKELVKEFVGDAVELGLRLEERRGFNRRGRTKIYKIVKEVDRKLLDLTDAVLAKEKKGLDILNMVGEIKGLLINIYA 145 SCOP domains d2qupa_ A: automated matches SCOP domains CATH domains 2qupA00 A:24-145 TM1646-like domains CATH domains Pfam domains DUF327-2qupA01 A:24-145 Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------- Transcript 2qup A 24 GVSFSEVMGKQRDEKAYERLQALMSKIDDQGKLLSETRTIEELRKYKELVKEFVGDAVELGLRLEER---NRRGRTKIYKIVKEVDRKLLDLTDAVLAKEKKGLDILNMVGEIKGLLINIYA 145 33 43 53 63 73 83 | -| 103 113 123 133 143 90 94
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2QUP)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|