Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF AN ACID-SENSING ION CHANNEL 1 AT 1.9 A RESOLUTION AND LOW PH
 
Authors :  J. Jasti, H. Furukawa, E. B. Gonzales, E. Gouaux
Date :  02 Aug 07  (Deposition) - 25 Sep 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.90
Chains :  Asym. Unit :  A,B,C,D,E,F
Biol. Unit 1:  A,B,C  (1x)
Biol. Unit 2:  D,E,F  (1x)
Keywords :  Acid-Sensing, Ion Channel, Trimer, Membrane Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Jasti, H. Furukawa, E. B. Gonzales, E. Gouaux
Structure Of Acid-Sensing Ion Channel 1 At 1. 9A Resolution And Low Ph
Nature V. 449 316 2007
PubMed-ID: 17882215  |  Reference-DOI: 10.1038/NATURE06163

(-) Compounds

Molecule 1 - ACID-SENSING ION CHANNEL
    Chains: A, B, C, D, E, F
    Engineered: YES
    Expression System: SPODOPTERA FRUGIPERDA
    Expression System Common: FALL ARMYWORM
    Expression System Strain: SF9
    Expression System Taxid: 7108
    Expression System Vector Type: BACULOVIRUS
    Fragment: RESIDUES 26-463
    Gene: ACCN2
    Organism Common: CHICKEN
    Organism Scientific: GALLUS GALLUS
    Organism Taxid: 9031

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit : ABCDEF
Biological Unit 1 (1x): ABC   
Biological Unit 2 (1x):    DEF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 21)

Asymmetric Unit (3, 21)
No.NameCountTypeFull Name
1CL6Ligand/IonCHLORIDE ION
2MAL3Ligand/IonMALTOSE
3NAG12Ligand/IonN-ACETYL-D-GLUCOSAMINE
Biological Unit 1 (2, 9)
No.NameCountTypeFull Name
1CL-1Ligand/IonCHLORIDE ION
2MAL3Ligand/IonMALTOSE
3NAG6Ligand/IonN-ACETYL-D-GLUCOSAMINE
Biological Unit 2 (1, 6)
No.NameCountTypeFull Name
1CL-1Ligand/IonCHLORIDE ION
2MAL-1Ligand/IonMALTOSE
3NAG6Ligand/IonN-ACETYL-D-GLUCOSAMINE

(-) Sites  (0, 0)

(no "Site" information available for 2QTS)

(-) SS Bonds  (42, 42)

Asymmetric Unit
No.Residues
1A:94 -A:195
2A:173 -A:180
3A:291 -A:366
4A:309 -A:362
5A:313 -A:360
6A:322 -A:344
7A:324 -A:336
8B:94 -B:195
9B:173 -B:180
10B:291 -B:366
11B:309 -B:362
12B:313 -B:360
13B:322 -B:344
14B:324 -B:336
15C:94 -C:195
16C:173 -C:180
17C:291 -C:366
18C:309 -C:362
19C:313 -C:360
20C:322 -C:344
21C:324 -C:336
22D:94 -D:195
23D:173 -D:180
24D:291 -D:366
25D:309 -D:362
26D:313 -D:360
27D:322 -D:344
28D:324 -D:336
29E:94 -E:195
30E:173 -E:180
31E:291 -E:366
32E:309 -E:362
33E:313 -E:360
34E:322 -E:344
35E:324 -E:336
36F:94 -F:195
37F:173 -F:180
38F:291 -F:366
39F:309 -F:362
40F:313 -F:360
41F:322 -F:344
42F:324 -F:336

(-) Cis Peptide Bonds  (11, 11)

Asymmetric Unit
No.Residues
1Pro A:286 -Pro A:287
2Ile A:380 -Pro A:381
3Pro B:286 -Pro B:287
4Ile B:380 -Pro B:381
5Ile C:380 -Pro C:381
6Pro D:286 -Pro D:287
7Ile D:380 -Pro D:381
8Pro E:286 -Pro E:287
9Ile E:380 -Pro E:381
10Pro F:286 -Pro F:287
11Ile F:380 -Pro F:381

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2QTS)

(-) PROSITE Motifs  (1, 6)

Asymmetric Unit (1, 6)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ASCPS01206 Amiloride-sensitive sodium channels signature.ASIC1_CHICK304-324
 
 
 
 
 		  6A:304-324
B:304-324
C:304-324
D:304-324
E:304-324
F:304-324
Biological Unit 1 (1, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ASCPS01206 Amiloride-sensitive sodium channels signature.ASIC1_CHICK304-324
 
 
 
 
 		  3A:304-324
B:304-324
C:304-324
-
-
-
Biological Unit 2 (1, 3)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1ASCPS01206 Amiloride-sensitive sodium channels signature.ASIC1_CHICK304-324
 
 
 
 
 		  3-
-
-
D:304-324
E:304-324
F:304-324

(-) Exons   (0, 0)

(no "Exon" information available for 2QTS)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:417
 aligned with ASIC1_CHICK | Q1XA76 from UniProtKB/Swiss-Prot  Length:527

    Alignment length:417
                                    51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       
          ASIC1_CHICK    42 LKRVVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYAYE 458
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2qtsA01 A:42-73,A:424-458       2qtsA02                2qtsA03 A:97-164,A:226-245 acid-sensing ion channel 1 domain        2qtsA02 A:74-96,A:165-225,A:246-282,A:367-423                2qtsA03             2qtsA02                              2qtsA04 A:283-366 Acid-sensing ion channel domain                                   2qtsA02 A:74-96,A:165-225,A:246-282,A:367-423            2qtsA01 A:42-73,A:424-458 YojJ-like CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee....ee..eeeeee....hhhhhhhhhhhhhh...................hhhhhhhhhhh..........hhhhhhhhhh.hhhhheeeeee..ee.hhh.eeeeee..eeeeee..........ee...hhhh.eeeeee.hhhhh...............eeeeee......hhhhhheee...eeeeeeeeeeeee......................hhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhh...........eeeeeeeeeeeee.....hhhhhhhhhh.hhhhhhhheeeeeeeeeeeeeeeeeeee..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASC  PDB: A:304-324  -------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2qts A  42 LKRVVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYAYE 458
                                    51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       


Chain B from PDB  Type:PROTEIN  Length:420
 aligned with ASIC1_CHICK | Q1XA76 from UniProtKB/Swiss-Prot  Length:527

    Alignment length:420
                                    51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461
          ASIC1_CHICK    42 LKRVVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIK 461
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains 2qtsB01 B:42-73,B:424-461       2qtsB02                2qtsB03 B:97-164,B:226-245 acid-sensing ion channel 1 domain        2qtsB02 B:74-96,B:165-225,B:246-282,B:367-423                2qtsB03             2qtsB02                              2qtsB04 B:283-366 Acid-sensing ion channel domain                                   2qtsB02 B:74-96,B:165-225,B:246-282,B:367-423            2qtsB01 B:42-73,B:424-461 YojJ-like    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee....ee..eeeeee....hhhhhhhhhhhhhh..................hhhhhhhhhhhhh.........hhhhhhhhhh.hhhhheeeeee..ee.hhh.eeeeee..eeeeee..........ee...hhhh.eeeeee.hhhhh...............eeeeee......hhhhhheee...eeeeeeeeeeeee........ee............hhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhh........ee.eeeeeeeeeeeee.....hhhhhhhhh..hhhhhhhheeeeeeeeeeeeeeeeeeee..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASC  PDB: B:304-324  ----------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2qts B  42 LKRVVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIK 461
                                    51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451       461


Chain C from PDB  Type:PROTEIN  Length:418
 aligned with ASIC1_CHICK | Q1XA76 from UniProtKB/Swiss-Prot  Length:527

    Alignment length:418
                                    49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449        
          ASIC1_CHICK    40 LSLKRVVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYAY 457
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2qtsC01 C:40-73,C:424-457         2qtsC02                2qtsC03 C:97-164,C:226-245 acid-sensing ion channel 1 domain        2qtsC02 C:74-96,C:165-225,C:246-282,C:367-423                2qtsC03             2qtsC02                              2qtsC04 C:283-366 Acid-sensing ion channel domain                                   2qtsC02 C:74-96,C:165-225,C:246-282,C:367-423            2qtsC01 C:40-73,C:424-457          CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee....ee..eeeeee....hhhhhhhhhhhhhh..................hhhhhhhhhhhh..........hhhhhhhhhh.hhhhheeeeee..ee.hhh.eeeeee..eeeeee..........ee...hhhh.eeeeee.hhhhh...............eeeeee......hhhhhheee...eeeeeeeeeeeee......................hhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhh...........eeeeeeeeeeeee..hhhhhhhhhhhh..hhhhhhhheeeeeeeeeeeeeeeeeeee..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASC  PDB: C:304-324  ------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2qts C  40 LSLKRVVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYAY 457
                                    49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449        


Chain D from PDB  Type:PROTEIN  Length:415
 aligned with ASIC1_CHICK | Q1XA76 from UniProtKB/Swiss-Prot  Length:527

    Alignment length:415
                                    51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451     
          ASIC1_CHICK    42 LKRVVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYA 456
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2qtsD01 D:42-73,D:424-456       2qtsD02                2qtsD03 D:97-164,D:226-245 acid-sensing ion channel 1 domain        2qtsD02 D:74-96,D:165-225,D:246-282,D:367-423                2qtsD03             2qtsD02                              2qtsD04 D:283-366 Acid-sensing ion channel domain                                   2qtsD02 D:74-96,D:165-225,D:246-282,D:367-423            2qtsD01 D:42-73,D:424-456         CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee....ee..eeeeee....hhhhhhhhhhhhhh...................hhhhhhhhhhh..........hhhhhhhhhh.hhhhheeeeee..ee.hhh.eeeeee..eeeeee..........ee...hhhh.eeeeee.hhhhh...............eeeeee......hhhhhheee...eeeeeeeeeeeee........ee............hhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhh........ee.eeeeeeeeeeeee..hhhhhhhhhhhh..hhhhhhhheeeeeeeeeeeeeeeeeeee..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASC  PDB: D:304-324  ------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2qts D  42 LKRVVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYA 456
                                    51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451     


Chain E from PDB  Type:PROTEIN  Length:421
 aligned with ASIC1_CHICK | Q1XA76 from UniProtKB/Swiss-Prot  Length:527

    Alignment length:421
                                    50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460 
          ASIC1_CHICK    41 SLKRVVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIK 461
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2qtsE01 E:41-73,E:424-461        2qtsE02                2qtsE03 E:97-164,E:226-245 acid-sensing ion channel 1 domain        2qtsE02 E:74-96,E:165-225,E:246-282,E:367-423                2qtsE03             2qtsE02                              2qtsE04 E:283-366 Acid-sensing ion channel domain                                   2qtsE02 E:74-96,E:165-225,E:246-282,E:367-423            2qtsE01 E:41-73,E:424-461 YojJ-like    CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhhhhhh.....hhhhhhhhhhhhhhh...eeeeeeee....ee..eeeeee....hhhhhhhhhhhhhh..................hhhhhhhhhhhh..........hhhhhhhhhh.hhhhheeeeee..ee.hhh.eeeeee..eeeeee..........ee...hhhh.eeeeee.hhhhh...............eeeeee......hhhhhheee...eeeeeeeeeeeee......................hhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhh...........eeeeeeeeeeeee..hhhhhhhhhhhh..hhhhhhhheeeeeeeeeeeeeeeeeeee..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASC  PDB: E:304-324  ----------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2qts E  41 SLKRVVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIK 461
                                    50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420       430       440       450       460 


Chain F from PDB  Type:PROTEIN  Length:412
 aligned with ASIC1_CHICK | Q1XA76 from UniProtKB/Swiss-Prot  Length:527

    Alignment length:412
                                    51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451  
          ASIC1_CHICK    42 LKRVVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELF 453
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2qtsF01 F:42-73,F:424-453       2qtsF02                2qtsF03 F:97-164,F:226-245 acid-sensing ion channel 1 domain        2qtsF02 F:74-96,F:165-225,F:246-282,F:367-423                2qtsF03             2qtsF02                              2qtsF04 F:283-366 Acid-sensing ion channel domain                                   2qtsF02 F:74-96,F:165-225,F:246-282,F:367-423            2qtsF01 F:42-73,F:424-453      CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhh...eeeeeeee....ee..eeeeee....hhhhhhhhhhhhhh..................hhhhhhhhhhhh..........hhhhhhhhhh.hhhhheeeeee..ee.hhh.eeeeee..eeeeee..........ee...hhhh.eeeeee.hhhhh...............eeeeee......hhhhhheee...eeeeeeeeeeeee......................hhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhh...........eeeeeeeeeeeee..hhhhhhhhhhhh..hhhhhhhheeeeeeeeeeeeeeeeeeee..hhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ASC  PDB: F:304-324  --------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2qts F  42 LKRVVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELF 453
                                    51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331       341       351       361       371       381       391       401       411       421       431       441       451
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2QTS)

(-) CATH Domains  (4, 24)

Asymmetric Unit
(-)
Class: Mainly Alpha (13335)
(-)
Architecture: Orthogonal Bundle (10391)
(-)
Topology: acid-sensing ion channel 1 fold (3)
(-)
Homologous Superfamily: acid-sensing ion channel 1 domain (3)
(-)
Chicken (Gallus gallus) (1)
1a2qtsA03A:97-164,A:226-245
1b2qtsB03B:97-164,B:226-245
1c2qtsC03C:97-164,C:226-245
1d2qtsD03D:97-164,D:226-245
1e2qtsE03E:97-164,E:226-245
1f2qtsF03F:97-164,F:226-245
(-)
Topology: Helix Hairpins (718)
(-)
Homologous Superfamily: Acid-sensing ion channel domain (3)
(-)
Chicken (Gallus gallus) (1)
2a2qtsA04A:283-366
2b2qtsB04B:283-366
2c2qtsC04C:283-366
2d2qtsD04D:283-366
2e2qtsE04E:283-366
2f2qtsF04F:283-366
(-)
Homologous Superfamily: YojJ-like (4)
(-)
Chicken (Gallus gallus) (1)
3a2qtsA01A:42-73,A:424-458
3b2qtsD01D:42-73,D:424-456
3c2qtsC01C:40-73,C:424-457
3d2qtsB01B:42-73,B:424-461
3e2qtsF01F:42-73,F:424-453
3f2qtsE01E:41-73,E:424-461
(-)
Class: Mainly Beta (13760)
(-)
Architecture: Sandwich (5577)
(-)
Topology: Acid-sensing ion channels like fold (3)
(-)
Homologous Superfamily: Acid-sensing ion channels like domains (3)
(-)
Chicken (Gallus gallus) (1)
4a2qtsA02A:74-96,A:165-225,A:246-282,A:367-423
4b2qtsB02B:74-96,B:165-225,B:246-282,B:367-423
4c2qtsC02C:74-96,C:165-225,C:246-282,C:367-423
4d2qtsD02D:74-96,D:165-225,D:246-282,D:367-423
4e2qtsE02E:74-96,E:165-225,E:246-282,E:367-423
4f2qtsF02F:74-96,F:165-225,F:246-282,F:367-423

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2QTS)

(-) Gene Ontology  (25, 25)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D,E,F   (ASIC1_CHICK | Q1XA76)
molecular function
    GO:0044736    acid-sensing ion channel activity    Enables the transmembrane transfer of a sodium ion by a neuronal, voltage-insensitive channel that opens when an extracellular proton has been bound by the channel complex.
    GO:0005261    cation channel activity    Enables the energy-independent passage of cations across a lipid bilayer down a concentration gradient.
    GO:0022839    ion gated channel activity    Enables the transmembrane transfer of a solute by a channel that opens in response to a specific ion stimulus.
    GO:0015280    ligand-gated sodium channel activity    Enables the transmembrane transfer of a sodium ion by a channel that opens when a specific ligand has been bound by the channel complex or one of its constituent parts.
    GO:0005272    sodium channel activity    Enables the facilitated diffusion of a sodium ion (by an energy-independent process) involving passage through a transmembrane aqueous pore or channel without evidence for a carrier-mediated mechanism.
biological process
    GO:0008306    associative learning    Learning by associating a stimulus (the cause) with a particular outcome (the effect).
    GO:0070588    calcium ion transmembrane transport    A process in which a calcium ion is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
    GO:0006812    cation transport    The directed movement of cations, atoms or small molecules with a net positive charge, into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0071467    cellular response to pH    Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a pH stimulus. pH is a measure of the acidity or basicity of an aqueous solution.
    GO:0034220    ion transmembrane transport    A process in which an ion is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
    GO:0006811    ion transport    The directed movement of charged atoms or small charged molecules into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0007613    memory    The activities involved in the mental information processing system that receives (registers), modifies, stores, and retrieves informational stimuli. The main stages involved in the formation and retrieval of memory are encoding (processing of received information by acquisition), storage (building a permanent record of received information as a result of consolidation) and retrieval (calling back the stored information and use it in a suitable way to execute a given task).
    GO:0046929    negative regulation of neurotransmitter secretion    Any process that stops, prevents, or reduces the frequency, rate or extent of the regulated release of a neurotransmitter.
    GO:0070207    protein homotrimerization    The formation of a protein homotrimer, a macromolecular structure consisting of three noncovalently associated identical subunits.
    GO:0042391    regulation of membrane potential    Any process that modulates the establishment or extent of a membrane potential, the electric potential existing across any membrane arising from charges in the membrane itself and from the charges present in the media on either side of the membrane.
    GO:0010447    response to acidic pH    Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a pH stimulus with pH < 7. pH is a measure of the acidity or basicity of an aqueous solution.
    GO:0050915    sensory perception of sour taste    The series of events required to receive a sour taste stimulus, convert it to a molecular signal, and recognize and characterize the signal. This is a neurological process.
    GO:0035725    sodium ion transmembrane transport    A process in which a sodium ion is transported from one side of a membrane to the other by means of some agent such as a transporter or pore.
    GO:0006814    sodium ion transport    The directed movement of sodium ions (Na+) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
    GO:0006810    transport    The directed movement of substances (such as macromolecules, small molecules, ions) or cellular components (such as complexes and organelles) into, out of or within a cell, or between cells, or within a multicellular organism by means of some agent such as a transporter, pore or motor protein.
cellular component
    GO:0016021    integral component of membrane    The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0005887    integral component of plasma membrane    The component of the plasma membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
    GO:0016020    membrane    A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
    GO:0005886    plasma membrane    The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
    GO:0045202    synapse    The junction between a nerve fiber of one neuron and another neuron, muscle fiber or glial cell. As the nerve fiber approaches the synapse it enlarges into a specialized structure, the presynaptic nerve ending, which contains mitochondria and synaptic vesicles. At the tip of the nerve ending is the presynaptic membrane; facing it, and separated from it by a minute cleft (the synaptic cleft) is a specialized area of membrane on the receiving cell, known as the postsynaptic membrane. In response to the arrival of nerve impulses, the presynaptic nerve ending secretes molecules of neurotransmitters into the synaptic cleft. These diffuse across the cleft and transmit the signal to the postsynaptic membrane.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MAL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NAG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 2qts)
 
  Cis Peptide Bonds
    Ile A:380 - Pro A:381   [ RasMol ]  
    Ile B:380 - Pro B:381   [ RasMol ]  
    Ile C:380 - Pro C:381   [ RasMol ]  
    Ile D:380 - Pro D:381   [ RasMol ]  
    Ile E:380 - Pro E:381   [ RasMol ]  
    Ile F:380 - Pro F:381   [ RasMol ]  
    Pro A:286 - Pro A:287   [ RasMol ]  
    Pro B:286 - Pro B:287   [ RasMol ]  
    Pro D:286 - Pro D:287   [ RasMol ]  
    Pro E:286 - Pro E:287   [ RasMol ]  
    Pro F:286 - Pro F:287   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2qts
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ASIC1_CHICK | Q1XA76
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  ASIC1_CHICK | Q1XA76
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ASIC1_CHICK | Q1XA76: 3ij4 3s3w 3s3x 4fz0 4fz1 4ntw 4ntx 4nty 4nyk

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2QTS)