2QQ5 - JenaLib

Title :   CRYSTAL STRUCTURE OF HUMAN SDR FAMILY MEMBER 1

Authors :   E. S. Pilka, V. Hozjan, E. Ugochukwu, F. Von Delft, M. Sundstrom, C. H. Arrowsmith, J. Weigelt, A. Edwards, U. Oppermann, Structural G Consortium (Sgc)

Date :   26 Jul 07 (Deposition) - 07 Aug 07 (Release) - 13 Jul 11 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   1.80

Chains :   Asym. Unit : A
Biol. Unit 1: A  (2x)
Biol. Unit 2: A  (2x)
Biol. Unit 3: A  (4x)

Keywords :   Dhrs1, Sdr, Dehydrogenase, Reductase, Short-Chain, Structural Genomics Consortium, Sgc, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   E. S. Pilka, V. Hozjan, E. Ugochukwu, F. Von Delft, M. Sundstrom, C. H. Arrowsmith, J. Weigelt, A. Edwards, U. Oppermann
Crystal Structure Of Human Sdr Family Member 1.
To Be Published
PubMed: search

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (1, 1)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (1, 1)

Asymmetric Unit (1, 1)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_052318	T	241	I	DHRS1_HUMAN	Polymorphism	10134537	A	T	241	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_052318	T	241	I	DHRS1_HUMAN	Polymorphism	10134537	A	T	241	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (1, 2)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_052318	T	241	I	DHRS1_HUMAN	Polymorphism	10134537	A	T	241	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 3 (1, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_052318	T	241	I	DHRS1_HUMAN	Polymorphism	10134537	A	T	241	I

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (0, 0)

Exons (7, 7)

Asymmetric Unit (7, 7)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.2	ENST00000396813	2	ENSE00001526345	chr14:24768666-24768422	245	DHRS1_HUMAN	-	0	0	-	-
1.3	ENST00000396813	3	ENSE00001391390	chr14:24768336-24768163	174	DHRS1_HUMAN	1-50	50	1	A:3-50	48
1.4	ENST00000396813	4	ENSE00001032203	chr14:24766087-24765944	144	DHRS1_HUMAN	51-98	48	1	A:51-98	48
1.5	ENST00000396813	5	ENSE00001032191	chr14:24765794-24765715	80	DHRS1_HUMAN	99-125	27	1	A:99-125	27
1.6	ENST00000396813	6	ENSE00001032196	chr14:24761990-24761858	133	DHRS1_HUMAN	125-169	45	1	A:125-169	45
1.7	ENST00000396813	7	ENSE00001032193	chr14:24761536-24761390	147	DHRS1_HUMAN	170-218	49	1	A:170-201	32
1.8	ENST00000396813	8	ENSE00001032186	chr14:24760831-24760762	70	DHRS1_HUMAN	219-242	24	1	A:224-242	19
1.9	ENST00000396813	9	ENSE00001032180	chr14:24760425-24760345	81	DHRS1_HUMAN	242-269	28	1	A:242-262	21
1.10a	ENST00000396813	10a	ENSE00001526343	chr14:24760201-24759806	396	DHRS1_HUMAN	269-313	45	0	-	-

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:238
 aligned with DHRS1_HUMAN | Q96LJ7 from UniProtKB/Swiss-Prot  Length:313

    Alignment length:260
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262
          DHRS1_HUMAN     3 APMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEVRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQGLIVVISSPGSLQYMFNVPYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLKEHMAKEEVLQDPVLKQFKSAFSSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRY 262
               SCOP domains d2qq5a_ A: automated matches                                                                                                                                                                                                                                         SCOP domains
               CATH domains 2qq5A00 A:3-262 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                                  CATH domains
               Pfam domains -----adh_short-2qq5A01 A:8-182                                                                                                                                                      -------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee....hhhhhhhhhhhhhh..eeeeee.hhhhhhhhhhhhhhhh.eeeeee....hhhhhhhhhhhhhhhhh....eeee....hhhhhhhh..........hhhhhhhh..hhhhhhhhhhhhhhhhhhh..eeeee.hhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhh.eeeeee.........----------------------hhhhhhhhhhhhhhhhhh..hhhhhh..eeehhhhhhhh Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------I--------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.3  PDB: A:3-50 UniProt: 1-50 [INCOMPLETE]Exon 1.4  PDB: A:51-98 UniProt: 51-98           Exon 1.5  PDB: A:99-125    --------------------------------------------Exon 1.7  PDB: A:170-201 UniProt: 170-218        Exon 1.8  PDB: A:224-242-------------------- Transcript 1 (1)
           Transcript 1 (2) --------------------------------------------------------------------------------------------------------------------------Exon 1.6  PDB: A:125-169 UniProt: 125-169    ------------------------------------------------------------------------Exon 1.9 [INCOMPLETE] Transcript 1 (2)
                 2qq5 A   3 APMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEVRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQGLIVVISSPGSLQYMFNVPYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELL----------------------SSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRY 262
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142       152       162       172       182       192        |-         -         - |     232       242       252       262
                                                                                                                                                                                                                                201                    224

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 1)

CATH Domains (1, 1)

Pfam Domains (1, 1)

Gene Ontology (6, 6)

Asymmetric Unit(hide GO term definitions)

Chain A (DHRS1_HUMAN | Q96LJ7)

molecular function
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005743	mitochondrial inner membrane	The inner, i.e. lumen-facing, lipid bilayer of the mitochondrial envelope. It is highly folded to form cristae.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.

Visualization

Interactive Views

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2qq5)

	Sites
(no "Sites" information available for 2qq5)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2qq5)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]
		Biological Unit 3	[ Jena3D ]

Still Images

Databases and Analysis Tools

Databases

Access by PDB/NDB ID
	2qq5
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	DHRS1_HUMAN \| Q96LJ7
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	1.1.-.-
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Description