Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit - manually
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit - manually
Asym./Biol. Unit - manually  (Jmol Viewer)
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF AN ASPARTOACYLASE FAMILY PROTEIN (MLR6093) FROM MESORHIZOBIUM LOTI MAFF303099 AT 2.00 A RESOLUTION
 
Authors :  Joint Center For Structural Genomics (Jcsg)
Date :  06 Jul 07  (Deposition) - 24 Jul 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Structural Genomics, Joint Center For Structural Genomics, Jcsg, Protein Structure Initiative, Psi-2, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  Joint Center For Structural Genomics (Jcsg)
Crystal Structure Of Uncharacterized Protein Mlr6093 (Np_106651. 1) From Mesorhizobium Loti At 2. 00 A Resolution
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - MLR6093 PROTEIN
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: SPEEDET
    Expression System Strain: HK100
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: NP_106651.1, MLR6093
    Organism Scientific: MESORHIZOBIUM LOTI
    Organism Taxid: 266835
    Strain: MAFF303099

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 11)

Asymmetric/Biological Unit (1, 11)
No.NameCountTypeFull Name
1MSE11Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 2QJ8)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2QJ8)

(-) Cis Peptide Bonds  (1, 1)

Asymmetric/Biological Unit
No.Residues
1Phe A:109 -Pro A:110

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2QJ8)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2QJ8)

(-) Exons   (0, 0)

(no "Exon" information available for 2QJ8)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:314
 aligned with Q98AA0_RHILO | Q98AA0 from UniProtKB/TrEMBL  Length:331

    Alignment length:330
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251       261       271       281       291       301       311       321       331
         Q98AA0_RHILO     2 SEAPHLTFDLDTPGVSTGHLVVPKGADCEALSLPVFSCNRGEGPSLLITGGNHGNELQGPILARRLVKWLPEAQRCGRIIIVPEINPLAVQAWTRNTPIDGKNLNRVFPGRSDGSVSERIADAISRLLLPVVDTVLDLHSFGPTWDCAPSIISHPIADIDQMTKTVSISKAFKLPVTLLWEHNETDGMFDTLVHRQGKTFICTEFGGGVVSAEALTIYEAGVRNGLIALGLVKGKAEYPTFRQQKTGQTLETTSSDQLKSPSPGIFEPRCSVMDEVEQGDVVGVLHPMGSLSAASIDIRAQSKSTVFAIRSAMYVQGNEEVAILARPLAR 331
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ....ee.......eeeeeeeee........eeeeeeeeee....eeeeee......hhhhhhhhhhhhhhhhhh..eeeeee...hhhhhhhh.....................hhhhhhhhhhhhhhhhhh.eeeeeeeee..eee..eeee....hhhhhhhhhhhhhh....eeeee......hhhhhhh.....eeeeeeee..------hhhhhhhhhhhhhhh.......----------.eeeeehhh.eee....eeeee......ee....eeeeee.........eeee....eeeeeee..eee....eeeeeeee... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2qj8 A   2 SEAPHLTFDLDTPGVSTGHLVVPKGADCEALSLPVFSCNRGEGPSLLITGGNHGNELQGPILARRLVKWLPEAQRCGRIIIVPEINPLAVQAWTRNTPIDGKNLNRVFPGRSDGSVSERIADAISRLLLPVVDTVLDLHSFGPTWDCAPSIISHPIADIDQmTKTVSISKAFKLPVTLLWEHNETDGmFDTLVHRQGKTFICTEFGGG------LTIYEAGVRNGLIALGLVKGKA----------GQTLETTSSDQLKSPSPGIFEPRCSVmDEVEQGDVVGVLHPmGSLSAASIDIRAQSKSTVFAIRSAmYVQGNEEVAILARPLAR 331
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161 |     171       181       191       201       | -    |  221       231     |   -      |251       261       271  |    281       291       301       311  |    321       331
                                                                                                                                                                                           163-MSE                   189-MSE             209    216                  237        248                       274-MSE        289-MSE                  314-MSE             


Chain B from PDB  Type:PROTEIN  Length:289
 aligned with Q98AA0_RHILO | Q98AA0 from UniProtKB/TrEMBL  Length:331

    Alignment length:330
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330
         Q98AA0_RHILO     1 MSEAPHLTFDLDTPGVSTGHLVVPKGADCEALSLPVFSCNRGEGPSLLITGGNHGNELQGPILARRLVKWLPEAQRCGRIIIVPEINPLAVQAWTRNTPIDGKNLNRVFPGRSDGSVSERIADAISRLLLPVVDTVLDLHSFGPTWDCAPSIISHPIADIDQMTKTVSISKAFKLPVTLLWEHNETDGMFDTLVHRQGKTFICTEFGGGVVSAEALTIYEAGVRNGLIALGLVKGKAEYPTFRQQKTGQTLETTSSDQLKSPSPGIFEPRCSVMDEVEQGDVVGVLHPMGSLSAASIDIRAQSKSTVFAIRSAMYVQGNEEVAILARPLA 330
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
           Pfam domains (1) -------------------------   --------------AstE_AspA-2qj8B01 B:43-328                                                                                                                                                                                                                                                                    -- Pfam domains (1)
           Pfam domains (2) -------------------------   --------------AstE_AspA-2qj8B02 B:43-328                                                                                                                                                                                                                                                                    -- Pfam domains (2)
         Sec.struct. author .....ee.......eeeeeeeee..---...eeeeeeeeee....eeeeee......hhhhhhhhhhhhhhhhhh..eeeeee.......-------------------------hhhhhhhhhhhhhhhhhh.eeeeeee....eee..eeee.-----hhhhhhhhhhhhh...eeeee.------hhhhhhhh...eeeeeee......--hhhhhhhhhhhhhhhhh.................eeeeehhh.eee....eeeee......ee....eeeeee.........eeee....eeeeeee..eee....eeeeeeee.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2qj8 B   1 mSEAPHLTFDLDTPGVSTGHLVVPK---CEALSLPVFSCNRGEGPSLLITGGNHGNELQGPILARRLVKWLPEAQRCGRIIIVPEINPLA-------------------------SVSERIADAISRLLLPVVDTVLDLHSFGPTWDCAPSIISH-----DQmTKTVSISKAFKLPVTLLWE------mFDTLVHRQGKTFICTEFGGGVVS--ALTIYEAGVRNGLIALGLVKGKAEYPTFRQQKTGQTLETTSSDQLKSPSPGIFEPRCSVmDEVEQGDVVGVLHPmGSLSAASIDIRAQSKSTVFAIRSAmYVQGNEEVAILARPLA 330
                            |       10        20    |   30        40        50        60        70        80        90         -         -     | 120       130       140       150    |    -| |    170       180 |     190       200       210 |  |  220       230       240       250       260       270   |   280       290       300       310   |   320       330
                            1-MSE                  25  29                                                           90                       116                                    155   161 |                182      |                    212  |                                                        274-MSE        289-MSE                  314-MSE            
                                                                                                                                                                                            163-MSE                   189-MSE                   215
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2QJ8)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2QJ8)

(-) Pfam Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Clan: Peptidase_MH (119)

(-) Gene Ontology  (4, 4)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (Q98AA0_RHILO | Q98AA0)
molecular function
    GO:0016787    hydrolase activity    Catalysis of the hydrolysis of various bonds, e.g. C-O, C-N, C-C, phosphoric anhydride bonds, etc. Hydrolase is the systematic name for any enzyme of EC class 3.
    GO:0016788    hydrolase activity, acting on ester bonds    Catalysis of the hydrolysis of any ester bond.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0008152    metabolic process    The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 2qj8)
 
  Cis Peptide Bonds
    Phe A:109 - Pro A:110   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2qj8
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q98AA0_RHILO | Q98AA0
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q98AA0_RHILO | Q98AA0
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2QJ8)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2QJ8)