Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)

(-) Description

Title :  STRUCTURAL BASIS OF OCTANOIC ACID RECOGNITION BY LIPOATE-PROTEIN LIGASE B
 
Authors :  D. J. Kim, S. J. Lee, H. S. Kim, K. H. Kim, H. H. Lee, H. J. Yoon, S. W. Suh
Date :  02 Jul 07  (Deposition) - 26 Feb 08  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.50
Chains :  Asym./Biol. Unit :  A
Keywords :  Globular Protein, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. J. Kim, S. J. Lee, H. S. Kim, K. H. Kim, H. H. Lee, H. J. Yoon, S. W. Suh
Structural Basis Of Octanoic Acid Recognition By Lipoate-Protein Ligase B
Proteins V. 70 1620 2008
PubMed-ID: 18076036  |  Reference-DOI: 10.1002/PROT.21843

(-) Compounds

Molecule 1 - LIPOYLTRANSFERASE
    Chains: A
    EC Number: 2.3.1.-
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET28B
    Expression System Strain: ROSETTA2 (DE3) PLYSS
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: TTC 1746
    Organism Scientific: THERMUS THERMOPHILUS
    Organism Taxid: 300852
    Strain: HB8
    Synonym: LIPB, LIPOYL-[ACYL-CARRIER-PROTEIN]-PROTEIN- N- LIPOYLTRANSFERASE, LIPOATE-PROTEIN LIGASE B

 Structural Features

(-) Chains, Units

  1
Asymmetric/Biological Unit : A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2QHT)

(-) Sites  (0, 0)

(no "Site" information available for 2QHT)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2QHT)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2QHT)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2QHT)

(-) PROSITE Motifs  (2, 2)

Asymmetric/Biological Unit (2, 2)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1BPL_LPL_CATALYTICPS51733 Biotinyl protein ligase (BPL) and lipoyl protein ligase (LPL) catalytic domain profile.LIPB_THET830-209  1A:30-209
2LIPBPS01313 Lipoate-protein ligase B signature.LIPB_THET875-90  1A:75-90

(-) Exons   (0, 0)

(no "Exon" information available for 2QHT)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:210
 aligned with LIPB_THET8 | Q5SLQ3 from UniProtKB/Swiss-Prot  Length:217

    Alignment length:210
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210
           LIPB_THET8     1 MEFLVEDLGLVPYGEAWAYQKRVHREVVAGNRPPTLLLLEHPRVITLGRKATGENLLFPESWYRENGFELYWVERGGDVTYHGPGQLVGYPIFPVGREVRRFLRQIEEAIVRVAAGYGISAYPTPGYAGVWVGEDKLCAIGVAVKEGVSFHGFALNVNTDLNDFTVIVPCGLKGKGVTSLEKLLGRKVPMEEAKARVVAAFAEVFGLRPV 210
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains -----------------------------------------------BPL_LplA_LipB-2qhtA01 A:48-160                                                                                   -------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeeeeee.hhhhhhhhhhhhhhhhhh.....eeeeee...eeee....hhhhh..hhhhhhhh..eeee......eeee...eeeeeee.....hhhhhhhhhhhhhhhhhhhh............eee..eeeeeeeeeee..eeeeeeeee...hhhhhhhh........ee.hhhhhhh...hhhhhhhhhhhhhhhhhh.eee Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                PROSITE (1) -----------------------------BPL_LPL_CATALYTIC  PDB: A:30-209 UniProt: 30-209                                                                                                                                    - PROSITE (1)
                PROSITE (2) --------------------------------------------------------------------------LIPB            ------------------------------------------------------------------------------------------------------------------------ PROSITE (2)
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2qht A   1 MEFLVEDLGLVPYGEAWAYQKRVHREVVAGNRPPTLLLLEHPRVITLGRKATGENLLFPESWYRENGFELYWVERGGDVTYHGPGQLVGYPIFPVGREVRRFLRQIEEAIVRVAAGYGISAYPTPGYAGVWVGEDKLCAIGVAVKEGVSFHGFALNVNTDLNDFTVIVPCGLKGKGVTSLEKLLGRKVPMEEAKARVVAAFAEVFGLRPV 210
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2QHT)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2QHT)

(-) Pfam Domains  (1, 1)

Asymmetric/Biological Unit
(-)
Clan: tRNA_synt_II (64)

(-) Gene Ontology  (7, 7)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A   (LIPB_THET8 | Q5SLQ3)
molecular function
    GO:0033819    lipoyl(octanoyl) transferase activity    Catalysis of the reaction: octanoyl-[acyl-carrier protein] + protein = protein N6-(octanoyl)lysine + acyl-carrier protein.
    GO:0016415    octanoyltransferase activity    Catalysis of the transfer of an octanoyl (CH3-[CH2]6-CO-) group to an acceptor molecule.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
    GO:0016746    transferase activity, transferring acyl groups    Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor).
biological process
    GO:0006464    cellular protein modification process    The covalent alteration of one or more amino acids occurring in proteins, peptides and nascent polypeptides (co-translational, post-translational modifications) occurring at the level of an individual cell. Includes the modification of charged tRNAs that are destined to occur in a protein (pre-translation modification).
    GO:0009107    lipoate biosynthetic process    The chemical reactions and pathways resulting in the formation of lipoate, 1,2-dithiolane-3-pentanoate, the anion derived from lipoic acid.
cellular component
    GO:0005737    cytoplasm    All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2qht)
 
  Sites
(no "Sites" information available for 2qht)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2qht)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2qht
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  LIPB_THET8 | Q5SLQ3
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.3.1.-
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  LIPB_THET8 | Q5SLQ3
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        LIPB_THET8 | Q5SLQ3: 2qhs 2qhu 2qhv

(-) Related Entries Specified in the PDB File

2qhs 2qhu 2qhv