Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  PLASMODIUM YOELII ACYL CARRIER PROTEIN SYNTHASE PY06285 WITH ADP BOUND
 
Authors :  V. V. Lunin, A. K. Wernimont, J. Lew, G. Wasney, I. Kozieradzki, M. Vedad A. Bochkarev, C. H. Arrowsmith, M. Sundstrom, J. Weigelt, A. E. Edward S. Brokx, S. Altamentova, Structural Genomics Consortium (Sgc)
Date :  28 Jun 07  (Deposition) - 24 Jul 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A
Biol. Unit 1:  A  (3x)
Keywords :  Malaria, Acyl Carrier Protein Synthase, Py06285, 3'5'Adp, Sgc, Structural Genomics Consortium, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  V. V. Lunin, A. K. Wernimont, J. Lew, G. Wasney, I. Kozieradzki, M. Vedadi, A. Bochkarev, C. H. Arrowsmith, M. Sundstrom, J. Weigelt, A. E. Edwards, R. Hui, S. Brokx, S. Altamentova
Plasmodium Yoelii Acyl Carrier Protein Synthase Py06285 Wit Adp Bound
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - ACYL CARRIER PROTEIN SYNTHASE PY06285
    Chains: A
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: P15-MHL
    Expression System Strain: DH5A
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Organism Scientific: PLASMODIUM YOELII YOELII
    Organism Taxid: 73239
    Strain: YOELII

 Structural Features

(-) Chains, Units

  1
Asymmetric Unit : A
Biological Unit 1 (3x): A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 3)

Asymmetric Unit (2, 3)
No.NameCountTypeFull Name
1A3P1Ligand/IonADENOSINE-3'-5'-DIPHOSPHATE
2MG2Ligand/IonMAGNESIUM ION
Biological Unit 1 (1, 3)
No.NameCountTypeFull Name
1A3P3Ligand/IonADENOSINE-3'-5'-DIPHOSPHATE
2MG-1Ligand/IonMAGNESIUM ION

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASP A:151 , A3P A:202 , HOH A:243 , HOH A:254 , HOH A:259BINDING SITE FOR RESIDUE MG A 200
2AC2SOFTWAREASP A:30 , GLU A:92 , SER A:150 , A3P A:202 , HOH A:267 , HOH A:272 , HOH A:280BINDING SITE FOR RESIDUE MG A 201
3AC3SOFTWAREASP A:30 , LYS A:86 , GLU A:92 , LYS A:96 , GLY A:99 , ARG A:100 , GLY A:101 , ASN A:119 , TYR A:122 , GLY A:123 , LYS A:124 , PRO A:125 , ILE A:149 , SER A:150 , ASP A:151 , MG A:200 , MG A:201 , HOH A:228 , HOH A:250 , HOH A:259 , HOH A:267 , HOH A:277 , HOH A:280 , HOH A:286BINDING SITE FOR RESIDUE A3P A 202

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2QG8)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2QG8)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2QG8)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2QG8)

(-) Exons   (0, 0)

(no "Exon" information available for 2QG8)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:137
 aligned with Q7RB63_PLAYO | Q7RB63 from UniProtKB/TrEMBL  Length:521

    Alignment length:162
                                   368       378       388       398       408       418       428       438       448       458       468       478       488       498       508       518  
         Q7RB63_PLAYO   359 YSHHIIGIGTDILCVNRIYKILEKNINFIKKVLNPFELAEFETQKKKLNEKINKSNELKKLAIYVSKKFAAKEAILKSMGRGLSSISKYGLSMNDIEIKNDKYGKPHVYLYGKAKKVAYEMGIVKIFLSISDEKIINSQTNNISSNFPTFIIQAQALAVGSN 520
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------ACPS-2qg8A01 A:26-154                                                                                                                         -------------- Pfam domains
         Sec.struct. author ..eeeeeeeeeeeehhhhhhhhhhh..hhhhhhhhhhhhhhhhh.-------hhhhhhhhhhhhhhhhhhhhhhhhhhh.....-----..hhh.eeeee.....eeeeehhhhhhhhhhh...eeeeeeeee..-------------..eeeeeeeeeee. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2qg8 A  20 GSHHIIGIGTDILCVNRIYKILEKNINFIKKVLNPFELAEFETQK-------NKSNELKKLAIYVSKKFAAKEAILKSMGRGLS-----GLSMNDIEIKNDKYGKPHVYLYGKAKKVAYEMGIVKIFLSISDEKI-------------TFIIQAQALAVGSN 181
                                    29        39        49        59    |    -  |     79        89        99   |   109       119       129       139       149    |    -       169       179  
                                                                       64      72                            103   109                                          154           168
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2QG8)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2QG8)

(-) Pfam Domains  (1, 1)

Asymmetric Unit
(-)
Clan: no clan defined [family: ACPS] (13)

(-) Gene Ontology  (6, 6)

Asymmetric Unit(hide GO term definitions)
Chain A   (Q7RB63_PLAYO | Q7RB63)
molecular function
    GO:0008897    holo-[acyl-carrier-protein] synthase activity    Catalysis of the reaction: CoA + substrate-serine = adenosine 3',5'-bisphosphate + substrate-serine-4'-phosphopantetheine. The transfer of the 4'-phosphopantetheine (Ppant) co-factor from coenzyme A to the hydroxyl side chain of the serine residue of acyl- or peptidyl-carrier protein (ACP or PCP) to convert them from the apo to the holo form.
    GO:0000287    magnesium ion binding    Interacting selectively and non-covalently with magnesium (Mg) ions.
    GO:0004222    metalloendopeptidase activity    Catalysis of the hydrolysis of internal, alpha-peptide bonds in a polypeptide chain by a mechanism in which water acts as a nucleophile, one or two metal ions hold the water molecule in place, and charged amino acid side chains are ligands for the metal ions.
biological process
    GO:0006633    fatty acid biosynthetic process    The chemical reactions and pathways resulting in the formation of a fatty acid, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils. Fatty acids are predominantly straight-chain acids of 4 to 24 carbon atoms, which may be saturated or unsaturated; branched fatty acids and hydroxy fatty acids also occur, and very long chain acids of over 30 carbons are found in waxes.
    GO:0006508    proteolysis    The hydrolysis of proteins into smaller polypeptides and/or amino acids by cleavage of their peptide bonds.
    GO:0006364    rRNA processing    Any process involved in the conversion of a primary ribosomal RNA (rRNA) transcript into one or more mature rRNA molecules.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    A3P  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2qg8)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2qg8
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q7RB63_PLAYO | Q7RB63
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q7RB63_PLAYO | Q7RB63
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q7RB63_PLAYO | Q7RB63: 2bdd

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2QG8)