2Q7M - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   CRYSTAL STRUCTURE OF HUMAN FLAP WITH MK-591

Authors :   A. D. Ferguson

Date :   07 Jun 07 (Deposition) - 21 Aug 07 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   4.25

Chains :   Asym. Unit : A,B,C,D,E,F
Biol. Unit 1: A,B,C  (1x)
Biol. Unit 2: D,E,F  (1x)

Keywords :   Mapeg, Membrane Protein, Flap, Lipid Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   A. D. Ferguson, B. M. Mckeever, S. Xu, D. Wisniewski, D. K. Miller, T. T. Yamin, R. H. Spencer, L. Chu, F. Ujjainwalla, B. R. Cunningham, J. F. Evans, J. W. Becker
Crystal Structure Of Inhibitor-Bound Human 5-Lipoxygenase-Activating Protein.
Science V. 317 510 2007
PubMed-ID: 17600184 | Reference-DOI: 10.1126/SCIENCE.1144346
(for further references see the PDB file header)

Molecule 1 - ARACHIDONATE 5-LIPOXYGENASE-ACTIVATING PROTEIN
	Chains	:	A, B, C, D, E, F
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PET28A
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Gene	:	ALOX5AP, FLAP
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	FLAP, MK-886-BINDING PROTEIN

		1	2	3	4	5	6
Asymmetric Unit	:	A	B	C	D	E	F
Biological Unit 1 (1x)	:	A	B	C
Biological Unit 2 (1x)	:				D	E	F

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 6)

No.	Name	Count	Type	Full Name
1	2CS	6	Ligand/Ion	3-[3-(TERT-BUTYLTHIO)-1-(4-CHLOROBENZYL)-5-(QUINOLIN-2-YLMETHOXY)-1H-INDOL-2-YL]-2,2-DIMETHYLPROPANOIC ACID

Biological Unit 1 (1, 3)

No.	Name	Count	Type	Full Name
1	2CS	3	Ligand/Ion	3-[3-(TERT-BUTYLTHIO)-1-(4-CHLOROBENZYL)-5-(QUINOLIN-2-YLMETHOXY)-1H-INDOL-2-YL]-2,2-DIMETHYLPROPANOIC ACID

Biological Unit 2 (1, 3)

No.	Name	Count	Type	Full Name
1	2CS	3	Ligand/Ion	3-[3-(TERT-BUTYLTHIO)-1-(4-CHLOROBENZYL)-5-(QUINOLIN-2-YLMETHOXY)-1H-INDOL-2-YL]-2,2-DIMETHYLPROPANOIC ACID

Asymmetric Unit (6, 6)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	ASP B:62 , ALA B:63 , LYS B:116 , ILE B:119 , LEU B:120 , PHE B:123 , VAL C:21 , ASN C:23 , GLY C:24 , PHE C:25 , ALA C:27	BINDING SITE FOR RESIDUE 2CS C 501
2	AC2	SOFTWARE	VAL A:21 , ASN A:23 , GLY A:24 , PHE A:25 , ALA A:27 , HIS A:28 , ASP C:62 , ALA C:63 , ILE C:113 , ILE C:119 , LEU C:120	BINDING SITE FOR RESIDUE 2CS A 502
3	AC3	SOFTWARE	ASP A:62 , ALA A:63 , TYR A:112 , ILE A:113 , LYS A:116 , ILE A:119 , LEU A:120 , PHE A:123 , VAL B:21 , ASN B:23 , GLY B:24 , PHE B:25 , ALA B:27 , HIS B:28	BINDING SITE FOR RESIDUE 2CS A 503
4	AC4	SOFTWARE	VAL D:21 , ASN D:23 , GLY D:24 , PHE D:25 , ALA D:27 , ASN D:57 , ASP F:62 , ALA F:63 , LYS F:116 , ILE F:119 , LEU F:120	BINDING SITE FOR RESIDUE 2CS D 504
5	AC5	SOFTWARE	ASP D:62 , ALA D:63 , LYS D:116 , ILE D:119 , LEU D:120 , PHE D:123 , VAL E:21 , ASN E:23 , GLY E:24 , PHE E:25 , ALA E:27 , HIS E:28 , VAL E:61	BINDING SITE FOR RESIDUE 2CS E 505
6	AC6	SOFTWARE	ASP E:62 , ALA E:63 , ILE E:113 , LYS E:116 , ILE E:119 , LEU E:120 , PHE E:123 , VAL F:21 , ASN F:23 , GLY F:24 , PHE F:25 , ALA F:27	BINDING SITE FOR RESIDUE 2CS E 506

(no "SS Bond" information available for 2Q7M)

(no "Cis Peptide Bond" information available for 2Q7M)

(no "SAP(SNP)/Variant" information available for 2Q7M)

Asymmetric Unit (1, 6)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FLAP_GST2_LTC4S	PS01297	FLAP/GST2/LTC4S family signature.	AL5AP_HUMAN	46-60	6	A:46-60 B:46-60 C:46-60 D:46-60 E:46-60 F:46-60

Biological Unit 1 (1, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FLAP_GST2_LTC4S	PS01297	FLAP/GST2/LTC4S family signature.	AL5AP_HUMAN	46-60	3	A:46-60 B:46-60 C:46-60 - - -

Biological Unit 2 (1, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	FLAP_GST2_LTC4S	PS01297	FLAP/GST2/LTC4S family signature.	AL5AP_HUMAN	46-60	3	- - - D:46-60 E:46-60 F:46-60

Asymmetric Unit (5, 30)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000380490	1	ENSE00001485220	chr13:31309645-31309812	168	AL5AP_HUMAN	1-24	24	6	A:1-24 B:1-24 C:1-24 D:1-24 E:1-24 F:1-24	24 24 24 24 24 24
1.3a	ENST00000380490	3a	ENSE00000906667	chr13:31318197-31318296	100	AL5AP_HUMAN	24-57	34	6	A:24-57 B:24-57 C:24-57 D:24-57 E:24-57 F:24-57	34 34 34 34 34 34
1.4	ENST00000380490	4	ENSE00000906668	chr13:31326189-31326259	71	AL5AP_HUMAN	57-81	25	6	A:57-81 B:57-81 C:57-81 D:57-81 E:57-81 F:57-81	25 25 25 25 25 25
1.5	ENST00000380490	5	ENSE00000906669	chr13:31330081-31330162	82	AL5AP_HUMAN	81-108	28	6	A:81-108 B:81-108 C:81-108 D:81-108 E:81-108 F:81-108	28 28 28 28 28 28
1.6	ENST00000380490	6	ENSE00001093601	chr13:31338081-31338556	476	AL5AP_HUMAN	108-161	54	6	A:108-139 B:108-148 C:108-149 D:108-147 E:108-140 F:108-149	32 41 42 40 33 42

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:139
 aligned with AL5AP_HUMAN | P20292 from UniProtKB/Swiss-Prot  Length:161

    Alignment length:139
                                    10        20        30        40        50        60        70        80        90       100       110       120       130         
          AL5AP_HUMAN     1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFF 139
               SCOP domains d2q7ma1 A:1-139 Arachidonate 5-lipoxygenase-activating protein, FLAP                                                                        SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------FLAP_GST2_LTC4S------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: A:1-24   --------------------------------Exon 1.4  PDB: A:57-81   --------------------------Exon 1.6  PDB: A:108-139         Transcript 1 (1)
           Transcript 1 (2) -----------------------Exon 1.3a  PDB: A:24-57           -----------------------Exon 1.5  PDB: A:81-108     ------------------------------- Transcript 1 (2)
                 2q7m A   1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFF 139
                                    10        20        30        40        50        60        70        80        90       100       110       120       130

Chain B from PDB  Type:PROTEIN  Length:148
 aligned with AL5AP_HUMAN | P20292 from UniProtKB/Swiss-Prot  Length:161

    Alignment length:148
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140        
          AL5AP_HUMAN     1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIK 148
               SCOP domains d2q7mb1 B:1-139 Arachidonate 5-lipoxygenase-activating protein, FLAP                                                                       --------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhh...............hhhhhhhhhhhhhhhhhhhhhhhhhhhh..... Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------FLAP_GST2_LTC4S---------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: B:1-24   --------------------------------Exon 1.4  PDB: B:57-81   --------------------------Exon 1.6  PDB: B:108-148 UniProt: 108-161 Transcript 1 (1)
           Transcript 1 (2) -----------------------Exon 1.3a  PDB: B:24-57           -----------------------Exon 1.5  PDB: B:81-108     ---------------------------------------- Transcript 1 (2)
                 2q7m B   1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIA 148
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140

Chain C from PDB  Type:PROTEIN  Length:149
 aligned with AL5AP_HUMAN | P20292 from UniProtKB/Swiss-Prot  Length:161

    Alignment length:149
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140         
          AL5AP_HUMAN     1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKT 149
               SCOP domains d2q7mc1 C:1-139 Arachidonate 5-lipoxygenase-activating protein, FLAP                                                                       ---------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh..............hhhhhhhhhhhhhhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------FLAP_GST2_LTC4S----------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: C:1-24   --------------------------------Exon 1.4  PDB: C:57-81   --------------------------Exon 1.6  PDB: C:108-149 UniProt: 108-161  Transcript 1 (1)
           Transcript 1 (2) -----------------------Exon 1.3a  PDB: C:24-57           -----------------------Exon 1.5  PDB: C:81-108     ----------------------------------------- Transcript 1 (2)
                 2q7m C   1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIAT 149
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140

Chain D from PDB  Type:PROTEIN  Length:147
 aligned with AL5AP_HUMAN | P20292 from UniProtKB/Swiss-Prot  Length:161

    Alignment length:147
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       
          AL5AP_HUMAN     1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYI 147
               SCOP domains d2q7md1 D:1-139 Arachidonate 5-lipoxygenase-activating protein, FLAP                                                                       -------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhh.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------FLAP_GST2_LTC4S--------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: D:1-24   --------------------------------Exon 1.4  PDB: D:57-81   --------------------------Exon 1.6  PDB: D:108-147 [INCOMPLETE]    Transcript 1 (1)
           Transcript 1 (2) -----------------------Exon 1.3a  PDB: D:24-57           -----------------------Exon 1.5  PDB: D:81-108     --------------------------------------- Transcript 1 (2)
                 2q7m D   1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYI 147
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140

Chain E from PDB  Type:PROTEIN  Length:140
 aligned with AL5AP_HUMAN | P20292 from UniProtKB/Swiss-Prot  Length:161

    Alignment length:140
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140
          AL5AP_HUMAN     1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFG 140
               SCOP domains d2q7me1 E:1-139 Arachidonate 5-lipoxygenase-activating protein, FLAP                                                                       - SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhh...........hhhhhhhhhhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------FLAP_GST2_LTC4S-------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: E:1-24   --------------------------------Exon 1.4  PDB: E:57-81   --------------------------Exon 1.6  PDB: E:108-140          Transcript 1 (1)
           Transcript 1 (2) -----------------------Exon 1.3a  PDB: E:24-57           -----------------------Exon 1.5  PDB: E:81-108     -------------------------------- Transcript 1 (2)
                 2q7m E   1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFG 140
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140

Chain F from PDB  Type:PROTEIN  Length:149
 aligned with AL5AP_HUMAN | P20292 from UniProtKB/Swiss-Prot  Length:161

    Alignment length:149
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140         
          AL5AP_HUMAN     1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKT 149
               SCOP domains d2q7mf1 F:1-139 Arachidonate 5-lipoxygenase-activating protein, FLAP                                                                       ---------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ----MAPEG-2q7mF01 F:5-136                                                                                                               ------------- Pfam domains (1)
           Pfam domains (2) ----MAPEG-2q7mF02 F:5-136                                                                                                               ------------- Pfam domains (2)
           Pfam domains (3) ----MAPEG-2q7mF03 F:5-136                                                                                                               ------------- Pfam domains (3)
           Pfam domains (4) ----MAPEG-2q7mF04 F:5-136                                                                                                               ------------- Pfam domains (4)
           Pfam domains (5) ----MAPEG-2q7mF05 F:5-136                                                                                                               ------------- Pfam domains (5)
           Pfam domains (6) ----MAPEG-2q7mF06 F:5-136                                                                                                               ------------- Pfam domains (6)
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhh................hhhhhhhhhhhhhhhhhhhhhhh.......... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------FLAP_GST2_LTC4S----------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) Exon 1.1  PDB: F:1-24   --------------------------------Exon 1.4  PDB: F:57-81   --------------------------Exon 1.6  PDB: F:108-149 UniProt: 108-161  Transcript 1 (1)
           Transcript 1 (2) -----------------------Exon 1.3a  PDB: F:24-57           -----------------------Exon 1.5  PDB: F:81-108     ----------------------------------------- Transcript 1 (2)
                 2q7m F   1 MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIAT 149
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Membrane and cell surface proteins and peptides (2046)

Fold: MAPEG domain-like (9)

Superfamily: MAPEG domain-like (9)

Family: MAPEG domain (7)

Protein domain: Arachidonate 5-lipoxygenase-activating protein, FLAP (2)

Human (Homo sapiens) [TaxId: 9606] (2)

1a	d2q7ma1	A:1-139
1b	d2q7me1	E:1-139
1c	d2q7mf1	F:1-139
1d	d2q7mb1	B:1-139
1e	d2q7mc1	C:1-139
1f	d2q7md1	D:1-139

(no "CATH Domain" information available for 2Q7M)

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: no clan defined [family: MAPEG] (6)

Family: MAPEG (6)

Homo sapiens (Human) (6)

1a	MAPEG-2q7mF01	F:5-136
1b	MAPEG-2q7mF02	F:5-136
1c	MAPEG-2q7mF03	F:5-136
1d	MAPEG-2q7mF04	F:5-136
1e	MAPEG-2q7mF05	F:5-136
1f	MAPEG-2q7mF06	F:5-136

Asymmetric Unit(hide GO term definitions)

Chain A,B,C,D,E,F (AL5AP_HUMAN | P20292)

molecular function
	GO:0050544	arachidonic acid binding	Interacting selectively and non-covalently with arachidonic acid, a straight chain fatty acid with 20 carbon atoms and four double bonds per molecule. Arachidonic acid is the all-Z-(5,8,11,14)-isomer.
	GO:0008047	enzyme activator activity	Binds to and increases the activity of an enzyme.
	GO:0004602	glutathione peroxidase activity	Catalysis of the reaction: 2 glutathione + hydrogen peroxide = oxidized glutathione + 2 H2O.
	GO:0004364	glutathione transferase activity	Catalysis of the reaction: R-X + glutathione = H-X + R-S-glutathione. R may be an aliphatic, aromatic or heterocyclic group; X may be a sulfate, nitrile or halide group.
	GO:0004464	leukotriene-C4 synthase activity	Catalysis of the reaction: leukotriene C(4) = glutathione + leukotriene A(4).
	GO:0047485	protein N-terminus binding	Interacting selectively and non-covalently with a protein N-terminus, the end of any peptide chain at which the 2-amino (or 2-imino) function of a constituent amino acid is not attached in peptide linkage to another amino-acid residue.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0071277	cellular response to calcium ion	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a calcium ion stimulus.
	GO:0019370	leukotriene biosynthetic process	The chemical reactions and pathways resulting in the formation of leukotriene, a pharmacologically active substance derived from a polyunsaturated fatty acid, such as arachidonic acid.
	GO:0006691	leukotriene metabolic process	The chemical reactions and pathways involving leukotriene, a pharmacologically active substance derived from a polyunsaturated fatty acid, such as arachidonic acid.
	GO:2001300	lipoxin metabolic process	The chemical reactions and pathways involving a lipoxin. A lipoxin is a non-classic eicosanoid and signalling molecule that has four conjugated double bonds and is derived from arachidonic acid.
	GO:0019372	lipoxygenase pathway	The chemical reactions and pathways by which an unsaturated fatty acid (such as arachidonic acid or linolenic acid) is converted to other compounds, and in which the first step is hydroperoxide formation catalyzed by lipoxygenase.
	GO:0043085	positive regulation of catalytic activity	Any process that activates or increases the activity of an enzyme.
	GO:0070207	protein homotrimerization	The formation of a protein homotrimer, a macromolecular structure consisting of three noncovalently associated identical subunits.
cellular component
	GO:0005783	endoplasmic reticulum	The irregular network of unit membranes, visible only by electron microscopy, that occurs in the cytoplasm of many eukaryotic cells. The membranes form a complex meshwork of tubular channels, which are often expanded into slitlike cavities called cisternae. The ER takes two forms, rough (or granular), with ribosomes adhering to the outer surface, and smooth (with no ribosomes attached).
	GO:0005789	endoplasmic reticulum membrane	The lipid bilayer surrounding the endoplasmic reticulum.
	GO:0016021	integral component of membrane	The component of a membrane consisting of the gene products and protein complexes having at least some part of their peptide sequence embedded in the hydrophobic region of the membrane.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0005635	nuclear envelope	The double lipid bilayer enclosing the nucleus and separating its contents from the rest of the cytoplasm; includes the intermembrane space, a gap of width 20-40 nm (also called the perinuclear space).
	GO:0031965	nuclear membrane	Either of the lipid bilayers that surround the nucleus and form the nuclear envelope; excludes the intermembrane space.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		2CS	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]
		AC5	[ RasMol ]	+environment [ RasMol ]
		AC6	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2q7m)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2q7m
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	AL5AP_HUMAN \| P20292
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	AL5AP_HUMAN \| P20292
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	AL5AP_HUMAN \| P20292	:	2q7r

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 6)

Sites (6, 6)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (1, 6)

Exons (5, 30)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 6)

CATH Domains (0, 0)

Pfam Domains (1, 6)

Gene Ontology (21, 21)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File