Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  STRUCTURE OF D-3-HYDROXYBUTYRATE DEHYDROGENASE FROM PSEUDOMONAS PUTIDA
 
Authors :  K. S. Paithankar, C. Feller, E. B. Kuettner, A. Keim, M. Grunow, N. Strat
Date :  29 May 07  (Deposition) - 30 Oct 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.02
Chains :  Asym. Unit :  A,B,C,D,E,F,G,H
Biol. Unit 1:  A,B,C,D  (1x)
Biol. Unit 2:  E,F  (2x)
Biol. Unit 3:  G,H  (1x)
Biol. Unit 4:  G,H  (2x)
Keywords :  Pseudomonas Putida, Sdr, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  K. S. Paithankar, C. Feller, E. B. Kuettner, A. Keim, M. Grunow, N. Strater
Cosubstrate-Induced Dynamics Of D-3-Hydroxybutyrate Dehydrogenase From Pseudomonas Putida.
Febs J. V. 274 5767 2007
PubMed-ID: 17958702  |  Reference-DOI: 10.1111/J.1742-4658.2007.06102.X

(-) Compounds

Molecule 1 - BETA-D-HYDROXYBUTYRATE DEHYDROGENASE
    ChainsA, B, C, D, E, F, G, H
    EC Number1.1.1.30
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneBDHA
    Organism ScientificPSEUDOMONAS PUTIDA
    Organism Taxid303

 Structural Features

(-) Chains, Units

  12345678
Asymmetric Unit ABCDEFGH
Biological Unit 1 (1x)ABCD    
Biological Unit 2 (2x)    EF  
Biological Unit 3 (1x)      GH
Biological Unit 4 (2x)      GH

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 6)

Asymmetric Unit (1, 6)
No.NameCountTypeFull Name
1NAD6Ligand/IonNICOTINAMIDE-ADENINE-DINUCLEOTIDE
Biological Unit 1 (1, 2)
No.NameCountTypeFull Name
1NAD2Ligand/IonNICOTINAMIDE-ADENINE-DINUCLEOTIDE
Biological Unit 2 (1, 4)
No.NameCountTypeFull Name
1NAD4Ligand/IonNICOTINAMIDE-ADENINE-DINUCLEOTIDE
Biological Unit 3 (1, 2)
No.NameCountTypeFull Name
1NAD2Ligand/IonNICOTINAMIDE-ADENINE-DINUCLEOTIDE
Biological Unit 4 (1, 4)
No.NameCountTypeFull Name
1NAD4Ligand/IonNICOTINAMIDE-ADENINE-DINUCLEOTIDE

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY C:12 , THR C:14 , SER C:15 , ILE C:17 , ASN C:35 , PHE C:37 , ALA C:59 , ASP C:60 , LEU C:61 , ASN C:87 , GLY C:89 , LEU C:110 , ILE C:137 , ALA C:138 , SER C:139 , TYR C:152 , LYS C:156 , PRO C:182 , GLY C:183 , TRP C:184 , VAL C:185 , THR C:187 , LEU C:189 , VAL C:190BINDING SITE FOR RESIDUE NAD C 300
2AC2SOFTWAREGLY D:12 , SER D:13 , THR D:14 , SER D:15 , GLY D:16 , ILE D:17 , ASN D:35 , PHE D:37 , ALA D:59 , ASP D:60 , LEU D:61 , ASN D:87 , ALA D:88 , GLY D:89 , LYS D:106 , ILE D:137 , ALA D:138 , SER D:139 , TYR D:152 , LYS D:156 , PRO D:182 , GLY D:183 , TRP D:184 , VAL D:185 , THR D:187 , PRO D:188 , LEU D:189 , VAL D:190 , HOH D:343 , HOH D:367BINDING SITE FOR RESIDUE NAD D 300
3AC3SOFTWAREGLY E:12 , THR E:14 , SER E:15 , GLY E:16 , ILE E:17 , ASN E:35 , GLY E:36 , PHE E:37 , ALA E:59 , ASP E:60 , LEU E:61 , ASN E:87 , ALA E:88 , GLY E:89 , LEU E:110 , ILE E:137 , ALA E:138 , TYR E:152 , LYS E:156 , PRO E:182 , GLY E:183 , TRP E:184 , VAL E:185 , THR E:187 , PRO E:188 , LEU E:189 , VAL E:190 , HOH E:334 , HOH E:344 , HOH E:354BINDING SITE FOR RESIDUE NAD E 300
4AC4SOFTWAREGLU B:102 , HOH B:333 , GLY F:12 , THR F:14 , SER F:15 , GLY F:16 , ILE F:17 , ASN F:35 , GLY F:36 , PHE F:37 , ALA F:59 , ASP F:60 , LEU F:61 , ASN F:87 , ALA F:88 , GLY F:89 , LEU F:110 , ALA F:138 , SER F:139 , TYR F:152 , LYS F:156 , PRO F:182 , GLY F:183 , TRP F:184 , VAL F:185 , THR F:187 , LEU F:189BINDING SITE FOR RESIDUE NAD F 300
5AC5SOFTWAREGLY G:12 , SER G:13 , THR G:14 , SER G:15 , GLY G:16 , ILE G:17 , ASN G:35 , PHE G:37 , ALA G:59 , ASP G:60 , LEU G:61 , ASN G:87 , ALA G:88 , GLY G:89 , ILE G:137 , ALA G:138 , SER G:139 , TYR G:152 , LYS G:156 , PRO G:182 , GLY G:183 , TRP G:184 , VAL G:185 , THR G:187 , PRO G:188 , LEU G:189 , VAL G:190BINDING SITE FOR RESIDUE NAD G 300
6AC6SOFTWAREGLU A:102 , GLY H:12 , THR H:14 , SER H:15 , GLY H:16 , ILE H:17 , ASN H:35 , PHE H:37 , ALA H:59 , ASP H:60 , LEU H:61 , ASN H:87 , ALA H:88 , GLY H:89 , LEU H:110 , ILE H:137 , ALA H:138 , SER H:139 , TYR H:152 , LYS H:156 , PRO H:182 , GLY H:183 , TRP H:184 , VAL H:185 , THR H:187BINDING SITE FOR RESIDUE NAD H 300

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2Q2Q)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2Q2Q)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2Q2Q)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2Q2Q)

(-) Exons   (0, 0)

(no "Exon" information available for 2Q2Q)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:250
 aligned with Q9AE70_PSEPU | Q9AE70 from UniProtKB/TrEMBL  Length:256

    Alignment length:255
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251     
         Q9AE70_PSEPU     2 TLKGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDPAPALAEIARHGVKAVHHPADLSDVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDRAANGGDPLQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGWLAQ 256
               SCOP domains d2q2qa_ A: automated matches                                                                                                                                                                                                                                    SCOP domains
               CATH domains 2q2qA00 A:2-256 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                             CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeee....hhhhhhhhhhhhhhh.eeeee....hhhhhhhhhh....eeee.....hhhhhhhhhhhhhhhhh...eeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeee.hhhhh.....hhhhhhhhhhhhhhhhhhhhhh....eeeeeeee....hhhhhhhhhhh-----hhhhhhhhhhh.........hhhhhhhhhhhhhhhhhh.....eeee....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2q2q A   2 TLKGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDPAPALAEIARHGVKAVHHPADLSDVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDR-----DPLQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGWLAQ 256
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191     |   - |     211       221       231       241       251     
                                                                                                                                                                                                                             197   203                                                     

Chain B from PDB  Type:PROTEIN  Length:252
 aligned with Q9AE70_PSEPU | Q9AE70 from UniProtKB/TrEMBL  Length:256

    Alignment length:255
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251     
         Q9AE70_PSEPU     2 TLKGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDPAPALAEIARHGVKAVHHPADLSDVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDRAANGGDPLQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGWLAQ 256
               SCOP domains d2q2qb_ B: automated matches                                                                                                                                                                                                                                    SCOP domains
               CATH domains 2q2qB00 B:2-256 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                             CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeee....hhhhhhhhhhhhhhh.eeeee....hhhhhhhhhh....eeee.....hhhhhhhhhhhhhhhhh...eeeee.......hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeee.hhhhh.....hhhhhhhhhhhhhhhhhhhhhh....eeeeeeee....hhhhhhhhhh..---.hhhhhhhhhhh.........hhhhhhhhhhhhhhhhhh.....eeee..hhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2q2q B   2 TLKGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDPAPALAEIARHGVKAVHHPADLSDVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDRA---GDPLQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGWLAQ 256
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191      |  -|      211       221       231       241       251     
                                                                                                                                                                                                                              198 202                                                      

Chain C from PDB  Type:PROTEIN  Length:243
 aligned with Q9AE70_PSEPU | Q9AE70 from UniProtKB/TrEMBL  Length:256

    Alignment length:255
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251     
         Q9AE70_PSEPU     2 TLKGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDPAPALAEIARHGVKAVHHPADLSDVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDRAANGGDPLQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGWLAQ 256
               SCOP domains d2q2qc_ C: automated matches                                                                                                                                                                                                                                    SCOP domains
               CATH domains 2q2qC00 C:2-256 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                             CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeee....hhhhhhhhhhhhhh..eeeee....hhhhhhhhhh....eeee.....hhhhhhhhhhhhhhhhh...eeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeee.hhhhh.....hhhhhhhhhhhhhhhhhhhhhh....eeeeeeee....hhhhhh..------------hhhhhh..........hhhhhhhhhhhhhhhhhh.....eeee....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2q2q C   2 TLKGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDPAPALAEIARHGVKAVHHPADLSDVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQI------------AQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGWLAQ 256
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191  |      -     | 211       221       231       241       251     
                                                                                                                                                                                                                          194          207                                                 

Chain D from PDB  Type:PROTEIN  Length:255
 aligned with Q9AE70_PSEPU | Q9AE70 from UniProtKB/TrEMBL  Length:256

    Alignment length:255
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251     
         Q9AE70_PSEPU     2 TLKGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDPAPALAEIARHGVKAVHHPADLSDVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDRAANGGDPLQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGWLAQ 256
               SCOP domains d2q2qd_ D: automated matches                                                                                                                                                                                                                                    SCOP domains
               CATH domains 2q2qD00 D:2-256 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                             CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeee....hhhhhhhhhhhhhh..eeeee....hhhhhhhhhh....eeee.....hhhhhhhhhhhhhhhhh...eeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeee.hhhhh.....hhhhhhhhhhhhhhhhhhhhhh....eeeeeeee....hhhhhhhhhhhhhh..hhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.....eeee..hhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2q2q D   2 TLKGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDPAPALAEIARHGVKAVHHPADLSDVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDRAANGGDPLQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGWLAQ 256
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251     

Chain E from PDB  Type:PROTEIN  Length:249
 aligned with Q9AE70_PSEPU | Q9AE70 from UniProtKB/TrEMBL  Length:256

    Alignment length:255
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251     
         Q9AE70_PSEPU     2 TLKGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDPAPALAEIARHGVKAVHHPADLSDVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDRAANGGDPLQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGWLAQ 256
               SCOP domains d2q2qe_ E: automated matches                                                                                                                                                                                                                                    SCOP domains
               CATH domains 2q2qE00 E:2-256 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                             CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeee....hhhhhhhhhhhhhh..eeeee....hhhhhhhhhhh...eeee.....hhhhhhhhhhhhhhhhh...eeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeee.hhhhh.....hhhhhhhhhhhhhhhhhhhhhh....eeeeeeee....hhhhhhhhhhh.------..hhhhhhhhhh......hhhhhhhhhhhhhhhhhh.....eeee..hhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2q2q E   2 TLKGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDPAPALAEIARHGVKAVHHPADLSDVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDRA------LQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGWLAQ 256
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191      |  -   |   211       221       231       241       251     
                                                                                                                                                                                                                              198    205                                                   

Chain F from PDB  Type:PROTEIN  Length:238
 aligned with Q9AE70_PSEPU | Q9AE70 from UniProtKB/TrEMBL  Length:256

    Alignment length:255
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251     
         Q9AE70_PSEPU     2 TLKGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDPAPALAEIARHGVKAVHHPADLSDVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDRAANGGDPLQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGWLAQ 256
               SCOP domains d2q2qf_ F: automated matches                                                                                                                                                                                                                                    SCOP domains
               CATH domains 2q2qF00 F:2-256 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                             CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeee....hhhhhhhhhhhhhh..eeeee...hhhhhhhhhhh....eeee.....hhhhhhhhhhhhhhhhh...eeee........hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeee.hhhhh.....hhhhhhhhhhhhhhhhhhhhhh....eeeeeeee.......-----------------hhhhhhhhhh......hhhhhhhhhhhhhhhhhh.....eeee..hhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2q2q F   2 TLKGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDPAPALAEIARHGVKAVHHPADLSDVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPL-----------------AQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGWLAQ 256
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       | -         -     | 211       221       231       241       251     
                                                                                                                                                                                                                     189               207                                                 

Chain G from PDB  Type:PROTEIN  Length:251
 aligned with Q9AE70_PSEPU | Q9AE70 from UniProtKB/TrEMBL  Length:256

    Alignment length:255
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251     
         Q9AE70_PSEPU     2 TLKGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDPAPALAEIARHGVKAVHHPADLSDVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDRAANGGDPLQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGWLAQ 256
               SCOP domains d2q2qg_ G: automated matches                                                                                                                                                                                                                                    SCOP domains
               CATH domains 2q2qG00 G:2-256 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                             CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....eeee....hhhhhhhhhhhhhh..eeeee....hhhhhhhhhh....eeee.....hhhhhhhhhhhhhhhhh...eeee.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeee.hhhhh.....hhhhhhhhhhhhhhhhhhhhhh....eeeeeeee....hhhhhhhhhhhhh----...hhhhhhhhhh......hhhhhhhhhhhhhhhhhh.....eeee....... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2q2q G   2 TLKGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDPAPALAEIARHGVKAVHHPADLSDVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDRAA----PLQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGWLAQ 256
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       | -  |    211       221       231       241       251     
                                                                                                                                                                                                                               199  204                                                    

Chain H from PDB  Type:PROTEIN  Length:240
 aligned with Q9AE70_PSEPU | Q9AE70 from UniProtKB/TrEMBL  Length:256

    Alignment length:255
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231       241       251     
         Q9AE70_PSEPU     2 TLKGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDPAPALAEIARHGVKAVHHPADLSDVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTPLVQKQIDDRAANGGDPLQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGWLAQ 256
               SCOP domains d2q2qh_ H: automated matches                                                                                                                                                                                                                                    SCOP domains
               CATH domains 2q2qH00 H:2-256 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                                             CATH domains
           Pfam domains (1) ----adh_short-2q2qH01 H:6-171                                                                                                                                             ------------------------------------------------------------------------------------- Pfam domains (1)
           Pfam domains (2) ----adh_short-2q2qH02 H:6-171                                                                                                                                             ------------------------------------------------------------------------------------- Pfam domains (2)
           Pfam domains (3) ----adh_short-2q2qH03 H:6-171                                                                                                                                             ------------------------------------------------------------------------------------- Pfam domains (3)
           Pfam domains (4) ----adh_short-2q2qH04 H:6-171                                                                                                                                             ------------------------------------------------------------------------------------- Pfam domains (4)
           Pfam domains (5) ----adh_short-2q2qH05 H:6-171                                                                                                                                             ------------------------------------------------------------------------------------- Pfam domains (5)
           Pfam domains (6) ----adh_short-2q2qH06 H:6-171                                                                                                                                             ------------------------------------------------------------------------------------- Pfam domains (6)
           Pfam domains (7) ----adh_short-2q2qH07 H:6-171                                                                                                                                             ------------------------------------------------------------------------------------- Pfam domains (7)
           Pfam domains (8) ----adh_short-2q2qH08 H:6-171                                                                                                                                             ------------------------------------------------------------------------------------- Pfam domains (8)
         Sec.struct. author .....eeee....hhhhhhhhhhhhhh..eeeee....hhhhhhhhhhhh..eeee.....hhhhhhhhhhhhhhhhh...eeee.............hhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeee.hhhhh.....hhhhhhhhhhhhhhhhhhhhhh....eeeeeeee......---------------.hhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.....eeee..hhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2q2q H   2 TLKGKTALVTGSTSGIGLGIAQVLARAGANIVLNGFGDPAPALAEIARHGVKAVHHPADLSDVAQIEALFALAEREFGGVDILVNNAGIQHVAPVEQFPLESWDKIIALNLSAVFHGTRLALPGMRARNWGRIINIASVHGLVGSTGKAAYVAAKHGVVGLTKVVGLETATSNVTCNAICPGWVLTP---------------PLQAQHDLLAEKQPSLAFVTPEHLGELVLFLCSEAGSQVRGAAWNVDGGWLAQ 256
                                    11        21        31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181      |  -         -  |    211       221       231       241       251     
                                                                                                                                                                                                                    188             204                                                    

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 8)

Asymmetric Unit

(-) CATH Domains  (1, 8)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 8)

Asymmetric Unit

(-) Gene Ontology  (4, 4)

Asymmetric Unit(hide GO term definitions)
Chain A,B,C,D,E,F,G,H   (Q9AE70_PSEPU | Q9AE70)
molecular function
    GO:0003858    3-hydroxybutyrate dehydrogenase activity    Catalysis of the reaction: (R)-3-hydroxybutanoate + NAD(+) = acetoacetate + H(+) + NADH.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    NAD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2q2q)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2q2q
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9AE70_PSEPU | Q9AE70
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  1.1.1.30
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q9AE70_PSEPU | Q9AE70
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q9AE70_PSEPU | Q9AE702q2v 2q2w

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2Q2Q)