Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF THE P95883_SULSO PROTEIN FROM SULFOLOBUS SOLFATARICUS. NESG TARGET SSR10.
 
Authors :  S. M. Vorobiev, Y. Chen, J. Seetharaman, D. Wang, L. Owens, L-C. Ma, K. Cunningham, Y. Fang, R. Xiao, T. B. Acton, G. T. Montelione, L. Tong, J. F. Hunt, Northeast Structural Genomics Consortium (Nesg)
Date :  18 May 07  (Deposition) - 29 May 07  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.40
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  P95883, Nesg, Sso2109, Structural Genomics, Psi-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. M. Vorobiev, Y. Chen, J. Seetharaman, D. Wang, L. Owens, L-C. Ma, K. Cunningham, Y. Fang, R. Xiao, T. B. Acton, G. T. Montelione, L. Tong, J. F. Hunt
Crystal Structure Of The P95883_sulso Protein From Sulfolobus Solfataricus.
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - ORF C02003 PROTEIN
    Atcc: 35092
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET21
    Expression System Strain: BL21(DE3)+MAGIC
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Gene: ORF C02003, SSO2109
    Organism Scientific: SULFOLOBUS SOLFATARICUS P2
    Organism Taxid: 273057
    Strain: P2, DSM 1617, JCM 11322

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2Q00)

(-) Sites  (0, 0)

(no "Site" information available for 2Q00)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2Q00)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2Q00)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2Q00)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2Q00)

(-) Exons   (0, 0)

(no "Exon" information available for 2Q00)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:120
 aligned with P95883_SULSF | P95883 from UniProtKB/TrEMBL  Length:121

    Alignment length:122
                                                                                                                                                 121  
                                    11        21        31        41        51        61        71        81        91       101       111       121  
         P95883_SULSF     2 SISTSAEVYYEEAEEFLSKGDLVQACEKYYKAAEEAIKLLVIENNLKEITNNVKNKGRWKSENLFKASKLLRSNNTEIPILWKSAWTLHVEGFHELSLNEKEVKKLKEDVRKLVIFAVNS--   -
               SCOP domains -------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2q00A00 A:2-123 Nucleotidyltransferases  domain 2                                                                          CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..--...hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------- Transcript
                 2q00 A   2 SISTSAEVYYEEAEEFLSKGDLVQACEKYYKAAEEAIKLLVIENNLKEITNNVK--GRWKSENLFKASKLLRSNNTEIPILWKSAWTLHVEGFHELSLNEKEVKKLKEDVRKLVIFAVNSLE 123
                                    11        21        31        41        51   |  | 61        71        81        91       101       111       121  
                                                                                55 58                                                                 


Chain B from PDB  Type:PROTEIN  Length:122
 aligned with P95883_SULSF | P95883 from UniProtKB/TrEMBL  Length:121

    Alignment length:122
                                                                                                                                                121   
                                    12        22        32        42        52        62        72        82        92       102       112        |-  
         P95883_SULSF     3 ISTSAEVYYEEAEEFLSKGDLVQACEKYYKAAEEAIKLLVIENNLKEITNNVKNKGRWKSENLFKASKLLRSNNTEIPILWKSAWTLHVEGFHELSLNEKEVKKLKEDVRKLVIFAVNS---   -
               SCOP domains -------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2q00B00 B:3-124 Nucleotidyltransferases  domain 2                                                                          CATH domains
           Pfam domains (1) PaREP1-2q00B01 B:3-115                                                                                           --------- Pfam domains (1)
           Pfam domains (2) PaREP1-2q00B02 B:3-115                                                                                           --------- Pfam domains (2)
         Sec.struct. author ..hhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhh.....hhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------- Transcript
                 2q00 B   3 ISTSAEVYYEEAEEFLSKGDLVQACEKYYKAAEEAIKLLVIENNLKEITNNVKNKGRWKSENLFKASKLLRSNNTEIPILWKSAWTLHVEGFHELSLNEKEVKKLKEDVRKLVIFAVNSLEH 124
                                    12        22        32        42        52        62        72        82        92       102       112       122
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2Q00)

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Mainly Alpha (13335)

(-) Pfam Domains  (1, 2)

Asymmetric Unit
(-)
Clan: KNTase_C (11)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 2Q00)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2q00)
 
  Sites
(no "Sites" information available for 2q00)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2q00)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Biol. Unit 1 PNG format | Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2q00
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  P95883_SULSF | P95883
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  P95883_SULSF | P95883
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        P95883_SULSF | P95883: 2jpu

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2Q00)