2PMI - JenaLib

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   STRUCTURE OF THE PHO85-PHO80 CDK-CYCLIN COMPLEX OF THE PHOSPHATE-RESPONSIVE SIGNAL TRANSDUCTION PATHWAY WITH BOUND ATP-GAMMA-S

Authors :   K. Huang, I. Ferrin-O'Connell, W. Zhang, G. A. Leonard, E. K. O'Shea, F.

Date :   23 Apr 07 (Deposition) - 11 Dec 07 (Release) - 15 Feb 12 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   2.90

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,B  (1x)
Biol. Unit 2: C,D  (1x)

Keywords :   Cyclin-Dependent Kinase, Cyclin, Signaling Protein, Transferase-Cell Cycle Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   K. Huang, I. Ferrin-O'Connell, W. Zhang, G. A. Leonard, E. K. O'Shea, F. A. Quiocho
Structure Of The Pho85-Pho80 Cdk-Cyclin Complex Of The Phosphate-Responsive Signal Transduction Pathway
Mol. Cell V. 28 614 2007
PubMed-ID: 18042456 | Reference-DOI: 10.1016/J.MOLCEL.2007.09.013

Molecule 1 - CYCLIN-DEPENDENT PROTEIN KINASE PHO85
	Chains	:	A, C
	EC Number	:	2.7.11.22
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PQE60
	Expression System Strain	:	BL21 (DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Gene	:	PHO85, SSG3
	Organism Common	:	BAKER'S YEAST
	Organism Scientific	:	SACCHAROMYCES CEREVISIAE
	Organism Taxid	:	4932
	Synonym	:	SERINE/THREONINE-PROTEIN KINASE PHO85

Molecule 2 - PHO85 CYCLIN PHO80
	Chains	:	B, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PSBET
	Expression System Strain	:	BL21 (DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Gene	:	PHO80, AGS3, TUP7, VAC5
	Organism Common	:	BAKER'S YEAST
	Organism Scientific	:	SACCHAROMYCES CEREVISIAE
	Organism Taxid	:	4932
	Synonym	:	PHOSPHATE SYSTEM CYCLIN PHO80

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A	B
Biological Unit 2 (1x)	:			C	D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (2, 3)

No.	Name	Count	Type	Full Name
1	AGS	1	Ligand/Ion	PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER
2	MES	2	Ligand/Ion	2-(N-MORPHOLINO)-ETHANESULFONIC ACID

Biological Unit 1 (2, 2)

No.	Name	Count	Type	Full Name
1	AGS	1	Ligand/Ion	PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER
2	MES	1	Ligand/Ion	2-(N-MORPHOLINO)-ETHANESULFONIC ACID

Biological Unit 2 (1, 1)

No.	Name	Count	Type	Full Name
1	AGS	-1	Ligand/Ion	PHOSPHOTHIOPHOSPHORIC ACID-ADENYLATE ESTER
2	MES	1	Ligand/Ion	2-(N-MORPHOLINO)-ETHANESULFONIC ACID

Asymmetric Unit (3, 3)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	SER B:69 , TYR B:80 , ARG B:83 , ARG B:121 , GLY B:148 , GLY B:149 , PRO C:240 , LYS C:241	BINDING SITE FOR RESIDUE MES B 1001
2	AC2	SOFTWARE	GLY A:182 , PRO A:240 , PRO D:73 , ARG D:83 , HIS D:120 , ARG D:121 , GLY D:148 , GLY D:149 , VAL D:150	BINDING SITE FOR RESIDUE MES D 2001
3	AC3	SOFTWARE	VAL A:21 , ALA A:34 , LYS A:36 , GLU A:83 , MET A:85 , ASN A:138 , LEU A:140 , ASP A:151	BINDING SITE FOR RESIDUE AGS A 3001

(no "SS Bond" information available for 2PMI)

(no "Cis Peptide Bond" information available for 2PMI)

(no "SAP(SNP)/Variant" information available for 2PMI)

Asymmetric Unit (2, 3)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PROTEIN_KINASE_ATP	PS00107	Protein kinases ATP-binding region signature.	PHO85_YEAST	13-36	1	C:20-36
2	PROTEIN_KINASE_ST	PS00108	Serine/Threonine protein kinases active-site signature.	PHO85_YEAST	129-141	2	A:129-141 C:129-141

Biological Unit 1 (1, 1)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PROTEIN_KINASE_ATP	PS00107	Protein kinases ATP-binding region signature.	PHO85_YEAST	13-36	0	-
2	PROTEIN_KINASE_ST	PS00108	Serine/Threonine protein kinases active-site signature.	PHO85_YEAST	129-141	1	A:129-141 -

Biological Unit 2 (2, 2)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	PROTEIN_KINASE_ATP	PS00107	Protein kinases ATP-binding region signature.	PHO85_YEAST	13-36	1	C:20-36
2	PROTEIN_KINASE_ST	PS00108	Serine/Threonine protein kinases active-site signature.	PHO85_YEAST	129-141	1	- C:129-141

Asymmetric Unit (3, 5)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	YOL001W	1	YOL001W.1	XV:325250-326131	882	PHO80_YEAST	1-293	293	2	B:17-247 (gaps) D:17-249 (gaps)	231 233

2.1	YPL031C	1	YPL031C.1	XVI:493035-493019	17	PHO85_YEAST	1-6	6	1	- C:6-6	- 1
2.2	YPL031C	2	YPL031C.2	XVI:492916-492016	901	PHO85_YEAST	6-305	300	2	A:19-302 C:6-301 (gaps)	284 296

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:284
 aligned with PHO85_YEAST | P17157 from UniProtKB/Swiss-Prot  Length:305

    Alignment length:284
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298    
          PHO85_YEAST    19 ATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHENIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTPNESLWPSVTKLPKYNPNIQQRPPRDLRQVLQPHTKEPLDGNLMDFLHGLLQLNPDMRLSAKQALHHPWFAEYYH 302
               SCOP domains d2pmia_ A: automated matches                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains 2pmiA01 A:19-86 Phosphorylase Kinase; domain 1                      2pmiA02 A:87-302 Transferase(Phosphotransferase) domain 1                                                                                                                                                                CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .eeeeee......eeeeeeee.......hhhhhhhhhhhh.........eeeee....eeeeeee....hhhhhhhhhhh.......hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee..................hhhhhh......hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh......hhhhhhh..............hhhhhhhhh....hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE PROTEIN_KINASE_ATP--------------------------------------------------------------------------------------------PROTEIN_KINAS----------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2 (1)
           Transcript 2 (2) Exon 2.2  PDB: A:19-302 UniProt: 6-305 [INCOMPLETE]                                                                                                                                                                                                                                          Transcript 2 (2)
                 2pmi A  19 ATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHENIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTPNESLWPSVTKLPKYNPNIQQRPPRDLRQVLQPHTKEPLDGNLMDFLHGLLQLNPDMRLSAKQALHHPWFAEYYH 302
                                    28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208       218       228       238       248       258       268       278       288       298

Chain B from PDB  Type:PROTEIN  Length:213
 aligned with PHO80_YEAST | P20052 from UniProtKB/Swiss-Prot  Length:293

    Alignment length:231
                                    26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246 
          PHO80_YEAST    17 GIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDDQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVIDKNALGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRKVDYVLPP 247
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .........hhhhhhhhhhhhhhhhhhhhhhhhhhh.--------..............hhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh....hhhhhhhhhh.hhhhhhhhhhhhhhh.........hhhhhhhhhh..........----------....hhhhhhhhhhhhhhhhhhhh.....hhhhh......... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: B:17-247 (gaps) UniProt: 1-293 [INCOMPLETE]                                                                                                                                                                              Transcript 1
                 2pmi B  17 GIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENS--------ITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVIDKN----------SYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRKVDYVLPP 247
                                    26        36        46      |  -     |  66        76        86        96       106       116       126       136       146       156       166       176       186       | -       206       216       226       236       246 
                                                               53       62                                                                                                                                 194        205

Chain C from PDB  Type:PROTEIN  Length:285
 aligned with PHO85_YEAST | P17157 from UniProtKB/Swiss-Prot  Length:305

    Alignment length:296
                                    15        25        35        45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295      
          PHO85_YEAST     6 QFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIREISLMKELKHENIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTPNESLWPSVTKLPKYNPNIQQRPPRDLRQVLQPHTKEPLDGNLMDFLHGLLQLNPDMRLSAKQALHHPWFAEYY 301
               SCOP domains d2pmic_        C: automated matche    s                                                                                                                                                                                                                                                                  SCOP domains
               CATH domains 2pmiC01        C:6-86 Phosphorylas    e Kinase; domain 1                         2pmiC02 C:87-301 Transferase(Phosphotransferase) domain 1                                                                                                                                                               CATH domains
           Pfam domains (1) -Pkinas       e-2pmiC01 C:7-297                                                                                                                                                                                                                                                                     ---- Pfam domains (1)
           Pfam domains (2) -Pkinas       e-2pmiC02 C:7-297                                                                                                                                                                                                                                                                     ---- Pfam domains (2)
         Sec.struct. author .......-------.ee..........eeeeee.----...hhhhhhhhhhhhhh.......eeeeeee..eeeeeee...eehhhhhhh..........hhhhhhhhhhhhhhhhhhhhhh.ee....hhh.eee.....eee......ee..................hhhhhh......hhhhhhhhhhhhhhhhhh.......hhhhhhhhhhhhhh......hhhhhhh.............hhhhhhhhhh....hhhhhhhhhhhh..hhhhh.hhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------PROTEIN_KINASE_ATP      --------------------------------------------------------------------------------------------PROTEIN_KINAS---------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 2 (1) 2------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2 (1)
           Transcript 2 (2) Exon 2.2  PDB: C:6-301 (gaps) UniProt: 6-305 [INCOMPLETE]                                                                                                                                                                                                                                                Transcript 2 (2)
                 2pmi C   6 QFKQLEK-------TVYKGLNKTTGVYVALKEVK----EGTPSTAIREISLMKELKHENIVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILAEMITGKPLFPGTNDEEQLKLIFDIMGTPNESLWPSVTKLPKYNPNIQQRPPRDLRQVLQPHTKEPLDGNLMDFLHGLLQLNPDMRLSAKQALHHPWFAEYY 301
                                  |  -    |   25        35   |    45        55        65        75        85        95       105       115       125       135       145       155       165       175       185       195       205       215       225       235       245       255       265       275       285       295      
                                 12      20                 39   44

Chain D from PDB  Type:PROTEIN  Length:216
 aligned with PHO80_YEAST | P20052 from UniProtKB/Swiss-Prot  Length:293

    Alignment length:233
                                    26        36        46        56        66        76        86        96       106       116       126       136       146       156       166       176       186       196       206       216       226       236       246   
          PHO80_YEAST    17 GIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKSDDQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVIDKNALGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRKVDYVLPPNI 249
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ----------------Cyclin-2pmiD01 D:33-1       70                                                                                                            ------------------------          --------------------------------------------- Pfam domains (1)
           Pfam domains (2) ----------------Cyclin-2pmiD02 D:33-1       70                                                                                                            ------------------------          --------------------------------------------- Pfam domains (2)
         Sec.struct. author ...eee...hhhhhhhhhhhhhhhhhhhhhhhhhhh.-------...............hhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhh........hhhhhhhhhhhhhhhhhh....hhhhhhhhhh.hhhhhhhhhhhhhhhhh.......hhhhhhhhh...........----------....hhhhhhhhhhhhhhhhhhhhh.....hhhhh..eee..... Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
               Transcript 1 Exon 1.1  PDB: D:17-249 (gaps) UniProt: 1-293 [INCOMPLETE]                                                                                                                                                                                Transcript 1
                 2pmi D  17 GIPKVILPADFNKCSRTDLVVLISRMLVSLIAINENS-------QITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTAHRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITLCSIEQKQKKFVIDKN----------SYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKSRKVDYVLPPNI 249
                                    26        36        46      |  -    |   66        76        86        96       106       116       126       136       146       156       166       176       186       | -       206       216       226       236       246   
                                                               53      61                                                                                                                                  194        205

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Asymmetric Unit

Classes(

)

Folds(

)

Superfamilies( (-)

)

Families(

)

Protein Domains( (-)

)

Organisms( (-)

)

Class: Alpha and beta proteins (a+b) (23004)

Fold: Protein kinase-like (PK-like) (2589)

Superfamily: Protein kinase-like (PK-like) (2589)

Family: automated matches (529)

Protein domain: automated matches (529)

Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932] (20)

1a	d2pmia_	A:
1b	d2pmic_	C:

Asymmetric Unit

Classes(

)

Architectures( (-)

)

Topologies( (-)

)

Homologous Superfamilies( (-)

)

Organisms( (-)

)

Class: Alpha Beta (26913)

Architecture: 2-Layer Sandwich (8480)

Topology: Phosphorylase Kinase; domain 1 (1392)

Homologous Superfamily: Phosphorylase Kinase; domain 1 (1392)

Baker's yeast (Saccharomyces cerevisiae) (32)

1a	2pmiC01	C:6-86
1b	2pmiA01	A:19-86

Class: Mainly Alpha (13335)

Architecture: Orthogonal Bundle (10391)

Topology: Transferase(Phosphotransferase); domain 1 (1379)

Homologous Superfamily: Transferase(Phosphotransferase) domain 1 (1379)

Baker's yeast (Saccharomyces cerevisiae) (21)

2a	2pmiC02	C:87-301
2b	2pmiA02	A:87-302

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: Cyclin (63)

Family: Cyclin (2)

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast) (2)

1a	Cyclin-2pmiD01	D:33-170
1b	Cyclin-2pmiD02	D:33-170

Clan: PKinase (934)

Family: Pkinase (680)

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast) (15)

2a	Pkinase-2pmiC01	C:7-297
2b	Pkinase-2pmiC02	C:7-297

Asymmetric Unit(hide GO term definitions)

Chain A,C (PHO85_YEAST | P17157)

molecular function
	GO:0005524	ATP binding	Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
	GO:0004693	cyclin-dependent protein serine/threonine kinase activity	Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate. This reaction requires the binding of a regulatory cyclin subunit and full activity requires stimulatory phosphorylation by a CDK-activating kinase (CAK).
	GO:0016301	kinase activity	Catalysis of the transfer of a phosphate group, usually from ATP, to a substrate molecule.
	GO:0000166	nucleotide binding	Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0004672	protein kinase activity	Catalysis of the phosphorylation of an amino acid residue in a protein, usually according to the reaction: a protein + ATP = a phosphoprotein + ADP.
	GO:0004674	protein serine/threonine kinase activity	Catalysis of the reactions: ATP + protein serine = ADP + protein serine phosphate, and ATP + protein threonine = ADP + protein threonine phosphate.
	GO:0016740	transferase activity	Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
	GO:0006974	cellular response to DNA damage stimulus	Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a stimulus indicating damage to its DNA from environmental insults or errors during metabolism.
	GO:0050849	negative regulation of calcium-mediated signaling	Any process that stops, prevents, or reduces the frequency, rate or extent of calcium-mediated signaling.
	GO:0045719	negative regulation of glycogen biosynthetic process	Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways resulting in the formation of glycogen.
	GO:0016242	negative regulation of macroautophagy	Any process that stops, prevents, or reduces the frequency, rate or extent of macroautophagy.
	GO:0045936	negative regulation of phosphate metabolic process	Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways involving phosphates.
	GO:0043433	negative regulation of sequence-specific DNA binding transcription factor activity	Any process that stops, prevents, or reduces the frequency, rate or extent of the activity of a transcription factor, any factor involved in the initiation or regulation of transcription.
	GO:0000122	negative regulation of transcription from RNA polymerase II promoter	Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0016310	phosphorylation	The process of introducing a phosphate group into a molecule, usually with the formation of a phosphoric ester, a phosphoric anhydride or a phosphoric amide.
	GO:0016239	positive regulation of macroautophagy	Any process, such as recognition of nutrient depletion, that activates or increases the rate of macroautophagy to bring cytosolic macromolecules to the vacuole/lysosome for degradation.
	GO:0006468	protein phosphorylation	The process of introducing a phosphate group on to a protein.
	GO:0051726	regulation of cell cycle	Any process that modulates the rate or extent of progression through the cell cycle.
	GO:0032878	regulation of establishment or maintenance of cell polarity	Any process that modulates the frequency, rate or extent of the specification, formation or maintenance of anisotropic intracellular organization or cell growth patterns.
	GO:0032880	regulation of protein localization	Any process that modulates the frequency, rate or extent of any process in which a protein is transported to, or maintained in, a specific location.
	GO:0031647	regulation of protein stability	Any process that affects the structure and integrity of a protein, altering the likelihood of its degradation or aggregation.
	GO:0000083	regulation of transcription involved in G1/S transition of mitotic cell cycle	Any process that regulates transcription such that the target genes are involved in the transition between G1 and S phase of the mitotic cell cycle.
cellular component
	GO:1990860	Pho85-Pho80 CDK-cyclin complex	A cyclin dependent kinase (CDK) complex that contains a kinase subunit and a regulatory cyclin subunit. An example of this complex in budding yeast S. cerevisiae consists of the Pho85 kinase and the Pho80 cyclin.
	GO:0000307	cyclin-dependent protein kinase holoenzyme complex	Cyclin-dependent protein kinases (CDKs) are enzyme complexes that contain a kinase catalytic subunit associated with a regulatory cyclin partner.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Chain B,D (PHO80_YEAST | P20052)

molecular function
	GO:0016538	cyclin-dependent protein serine/threonine kinase regulator activity	Modulates the activity of a cyclin-dependent protein serine/threonine kinase, enzymes of the protein kinase family that are regulated through association with cyclins and other proteins.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0019901	protein kinase binding	Interacting selectively and non-covalently with a protein kinase, any enzyme that catalyzes the transfer of a phosphate group, usually from ATP, to a protein substrate.
biological process
	GO:0006875	cellular metal ion homeostasis	Any process involved in the maintenance of an internal steady state of metal ions at the level of a cell.
	GO:0050849	negative regulation of calcium-mediated signaling	Any process that stops, prevents, or reduces the frequency, rate or extent of calcium-mediated signaling.
	GO:0016242	negative regulation of macroautophagy	Any process that stops, prevents, or reduces the frequency, rate or extent of macroautophagy.
	GO:0045936	negative regulation of phosphate metabolic process	Any process that stops, prevents, or reduces the frequency, rate or extent of the chemical reactions and pathways involving phosphates.
	GO:0000122	negative regulation of transcription from RNA polymerase II promoter	Any process that stops, prevents, or reduces the frequency, rate or extent of transcription from an RNA polymerase II promoter.
	GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	Any process that modulates the frequency, rate or extent of cyclin-dependent protein serine/threonine kinase activity.
	GO:0032880	regulation of protein localization	Any process that modulates the frequency, rate or extent of any process in which a protein is transported to, or maintained in, a specific location.
cellular component
	GO:1990860	Pho85-Pho80 CDK-cyclin complex	A cyclin dependent kinase (CDK) complex that contains a kinase subunit and a regulatory cyclin subunit. An example of this complex in budding yeast S. cerevisiae consists of the Pho85 kinase and the Pho80 cyclin.
	GO:0000307	cyclin-dependent protein kinase holoenzyme complex	Cyclin-dependent protein kinases (CDKs) are enzyme complexes that contain a kinase catalytic subunit associated with a regulatory cyclin partner.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		AGS	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]
		MES	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2pmi)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2pmi
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	PHO80_YEAST \| P20052
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	PHO85_YEAST \| P17157
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	2.7.11.22
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	(no 'MIM ID' available)
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	PHO80_YEAST \| P20052
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	PHO85_YEAST \| P17157
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	PHO80_YEAST \| P20052	:	2pk9
	PHO85_YEAST \| P17157	:	2pk9 4krc 4krd

2pk9	THE SAME PROTEIN COMPLEX WITHOUT ATP-GAMMA-S

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (2, 3)

Sites (3, 3)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (0, 0)

PROSITE Motifs (2, 3)

Exons (3, 5)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (2, 4)

Pfam Domains (2, 4)

Gene Ontology (31, 41)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File