Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Biological Unit 1
(-)Biological Unit 2
(-)Biological Unit 3
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF T110839 PROTEIN FROM SYNECHOCOCCUS ELONGATUS
 
Authors :  M. Madegowda, S. Eswaramoorthy, S. K. Burley, S. Swaminathan, New York Sgx Research Center For Structural Genomics (Nysgxrc)
Date :  19 Apr 07  (Deposition) - 01 May 07  (Release) - 24 Feb 09  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.60
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A,B  (1x)
Biol. Unit 2:  A (2x),B (2x)
Biol. Unit 3:  A,B  (2x)
Keywords :  Hypothetical, Uncharacterized, Duf1821, 10450C, Nysgxrc, Psi-2, Structural Genomics, Protein Structure Initiative, New York Sgx Research Center For Structural Genomics, Unknown Function (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  M. Madegowda, S. Eswaramoorthy, S. K. Burley, S. Swaminathan
Crystal Structure Of T110839 Protein From Synechococcus Elongatus.
To Be Published
PubMed: search
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - TLL0839 PROTEIN
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI BL21(DE3)
    Expression System PlasmidPSGX3(BC)
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneTLL0839
    Organism ScientificSYNECHOCOCCUS ELONGATUS
    Organism Taxid32046
    StrainBP-1

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit AB
Biological Unit 1 (1x)AB
Biological Unit 2 (2x)A (2x)B (2x)
Biological Unit 3 (2x)AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 4)

Asymmetric Unit (1, 4)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE
Biological Unit 1 (1, 4)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE
Biological Unit 2 (1, 4)
No.NameCountTypeFull Name
1MSE4Mod. Amino AcidSELENOMETHIONINE
Biological Unit 3 (1, 8)
No.NameCountTypeFull Name
1MSE8Mod. Amino AcidSELENOMETHIONINE

(-) Sites  (0, 0)

(no "Site" information available for 2PLG)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2PLG)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric Unit
No.Residues
1Leu A:83 -Pro A:84
2Leu B:83 -Pro B:84

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2PLG)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2PLG)

(-) Exons   (0, 0)

(no "Exon" information available for 2PLG)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:152
 aligned with Q8DKM0_THEEB | Q8DKM0 from UniProtKB/TrEMBL  Length:153

    Alignment length:152
                                    10        20        30        40        50        60        70        80        90       100       110       120       130       140       150  
         Q8DKM0_THEEB     1 MTMVSEVQPVSPASLDAPLENAVEIIETVISSLHQGDAPLVGQTDSGKIWMFRYGSAEVFVQLSGHTEEDFLTIWSPVLPLPVADELALYRKLLTLNWLTTFEAHFAIAEEQVQVVASRTLGGITAGEISRLITIVATLADDYDDALRAEFK 152
               SCOP domains d2plga1 A:3-154 Uncharacterized protein Tll0839                                                                                                          SCOP domains
               CATH domains --------------------2plgA01 A:23-154  [code=3.30.1460.10, no name defined]                                                                               CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....................hhhhhhhhhhhhhh.....eeeee..eeeeeeee..eeeeeee.......eeeeeeeeee....hhhhhhhhhhhhh.......eeeee..eeeeeeeee....hhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2plg A   3 LTmVSEVQPVSPASLDAPLENAVEIIETVISSLHQGDAPLVGQTDSGKIWmFRYGSAEVFVQLSGHTEEDFLTIWSPVLPLPVADELALYRKLLTLNWLTTFEAHFAIAEEQVQVVASRTLGGITAGEISRLITIVATLADDYDDALRAEFK 154
                              |     12        22        32        42        52|       62        72        82        92       102       112       122       132       142       152  
                              |                                              53-MSE                                                                                                 
                              5-MSE                                                                                                                                                 

Chain B from PDB  Type:PROTEIN  Length:147
 aligned with Q8DKM0_THEEB | Q8DKM0 from UniProtKB/TrEMBL  Length:153

    Alignment length:153
                             1                                                                                                                                                       
                             |       9        19        29        39        49        59        69        79        89        99       109       119       129       139       149   
         Q8DKM0_THEEB     - -MTMVSEVQPVSPASLDAPLENAVEIIETVISSLHQGDAPLVGQTDSGKIWMFRYGSAEVFVQLSGHTEEDFLTIWSPVLPLPVADELALYRKLLTLNWLTTFEAHFAIAEEQVQVVASRTLGGITAGEISRLITIVATLADDYDDALRAEFK 152
               SCOP domains d2plgb_ B:       Uncharacterized protein Tll0839                                                                                                          SCOP domains
               CATH domains 2plgB00 B:2      -154  [code=3.30.1460.10, no name defined]                                                                                               CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeee....------....hhhhhhhhhhhhhh.....eeeee..eeeeeeee..eeeeeee.......eeeeeeeeee....hhhhhhhhhhhhh.......eeeee..eeeeeeeee....hhhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2plg B   2 SLTmVSEVQPV------APLENAVEIIETVISSLHQGDAPLVGQTDSGKIWmFRYGSAEVFVQLSGHTEEDFLTIWSPVLPLPVADELALYRKLLTLNWLTTFEAHFAIAEEQVQVVASRTLGGITAGEISRLITIVATLADDYDDALRAEFK 154
                               |    11|      |21        31        41        51 |      61        71        81        91       101       111       121       131       141       151   
                               5-MSE 12     19                                53-MSE                                                                                                 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2PLG)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 2PLG)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MSE  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 2plg)
 
  Cis Peptide Bonds
    Leu A:83 - Pro A:84   [ RasMol ]  
    Leu B:83 - Pro B:84   [ RasMol ]  
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2plg
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8DKM0_THEEB | Q8DKM0
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q8DKM0_THEEB | Q8DKM0
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2PLG)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2PLG)