2PKG - JenaLib

Asym.Unit - manually (Jmol Viewer)

Asymmetric Unit (Jmol Viewer)

Asym. Unit - sites (Jmol Viewer)

Biological Unit 1 (Jmol Viewer)

Biol. Unit 1 - sites (Jmol Viewer)

Biological Unit 2 (Jmol Viewer)

Title :   STRUCTURE OF A COMPLEX BETWEEN THE A SUBUNIT OF PROTEIN PHOSPHATASE 2A AND THE SMALL T ANTIGEN OF SV40

Authors :   P. D. Jeffrey, Y. Shi

Date :   17 Apr 07 (Deposition) - 15 May 07 (Release) - 24 Feb 09 (Revision)

Method :   X-RAY DIFFRACTION

Resolution :   3.30

Chains :   Asym. Unit : A,B,C,D
Biol. Unit 1: A,C  (1x)
Biol. Unit 2: B,D  (1x)

Keywords :   Protein Phosphatase 2A, Small T Antigen, Sv40, Regulation, Hydrolase Regulator/Viral Protein Complex (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   Y. Chen, Y. Xu, Q. Bao, Y. Xing, Z. Li, Z. Lin, J. B. Stock, P. D. Jeffrey, Y. Shi
Structural And Biochemical Insights Into The Regulation Of Protein Phosphatase 2A By Small T Antigen Of Sv40.
Nat. Struct. Mol. Biol. V. 14 527 2007
PubMed-ID: 17529992 | Reference-DOI: 10.1038/NSMB1254
(for further references see the PDB file header)

Molecule 1 - SERINE/THREONINE-PROTEIN PHOSPHATASE 2A 65 KDA REGULATORY SUBUNIT A ALPHA ISOFORM
	Chains	:	A, B
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PGEX-2T
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Gene	:	PPP2R1A
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	PP2A, SUBUNIT A, PR65-ALPHA ISOFORM, PP2A, SUBUNIT A, R1-ALPHA ISOFORM, MEDIUM TUMOR ANTIGEN- ASSOCIATED 61 KDA PROTEIN

Molecule 2 - SMALL T ANTIGEN
	Chains	:	C, D
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI BL21(DE3)
	Expression System Plasmid	:	PGEX-2T
	Expression System Strain	:	BL21(DE3)
	Expression System Taxid	:	469008
	Expression System Vector Type	:	PLASMID
	Fragment	:	RESIDUES 87-174
	Organism Scientific	:	SIMIAN VIRUS 40
	Organism Taxid	:	10633

		1	2	3	4
Asymmetric Unit	:	A	B	C	D
Biological Unit 1 (1x)	:	A		C
Biological Unit 2 (1x)	:		B		D

Summary Information (see also Sequences/Alignments below)

Asymmetric Unit (1, 4)

No.	Name	Count	Type	Full Name
1	ZN	4	Ligand/Ion	ZINC ION

Biological Unit 1 (0, 0)

No.	Name	Count	Type	Full Name
1	ZN	-1	Ligand/Ion	ZINC ION

Biological Unit 2 (0, 0)

No.	Name	Count	Type	Full Name
1	ZN	-1	Ligand/Ion	ZINC ION

Asymmetric Unit (4, 4)

No.	Name	Evidence	Residues	Description
1	AC1	SOFTWARE	CYS C:103 , SER C:108 , CYS C:111 , CYS C:113 , CYS C:116	BINDING SITE FOR RESIDUE ZN C 175
2	AC2	SOFTWARE	HIS C:122 , CYS C:138 , CYS C:140 , CYS C:143	BINDING SITE FOR RESIDUE ZN C 176
3	AC3	SOFTWARE	CYS D:103 , CYS D:111 , CYS D:113 , CYS D:116	BINDING SITE FOR RESIDUE ZN D 175
4	AC4	SOFTWARE	HIS D:122 , CYS D:138 , CYS D:140 , CYS D:143	BINDING SITE FOR RESIDUE ZN D 176

(no "SS Bond" information available for 2PKG)

(no "Cis Peptide Bond" information available for 2PKG)

Asymmetric Unit (4, 8)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_073718	V	132	L	2AAA_HUMAN	Disease (MRD36)	---	A/B	V	132	L
2	UniProt	VAR_074488	P	179	L	2AAA_HUMAN	Disease (MRD36)	786205228	A/B	P	179	L
3	UniProt	VAR_074489	R	182	W	2AAA_HUMAN	Disease (MRD36)	786205227	A/B	R	182	W
4	UniProt	VAR_074490	R	258	H	2AAA_HUMAN	Disease (MRD36)	863225094	A/B	R	258	H

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_073718	V	132	L	2AAA_HUMAN	Disease (MRD36)	---	A	V	132	L
2	UniProt	VAR_074488	P	179	L	2AAA_HUMAN	Disease (MRD36)	786205228	A	P	179	L
3	UniProt	VAR_074489	R	182	W	2AAA_HUMAN	Disease (MRD36)	786205227	A	R	182	W
4	UniProt	VAR_074490	R	258	H	2AAA_HUMAN	Disease (MRD36)	863225094	A	R	258	H

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 2 (4, 4)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
1	UniProt	VAR_073718	V	132	L	2AAA_HUMAN	Disease (MRD36)	---	B	V	132	L
2	UniProt	VAR_074488	P	179	L	2AAA_HUMAN	Disease (MRD36)	786205228	B	P	179	L
3	UniProt	VAR_074489	R	182	W	2AAA_HUMAN	Disease (MRD36)	786205227	B	R	182	W
4	UniProt	VAR_074490	R	258	H	2AAA_HUMAN	Disease (MRD36)	863225094	B	R	258	H

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Asymmetric Unit (1, 22)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HEAT_REPEAT	PS50077	HEAT repeat profile.	2AAA_HUMAN	12-50 89-127 166-204 205-243 244-282 283-320 326-364 365-403 404-442 521-559 560-589	22	A:12-50 B:12-50 A:89-127 B:89-127 A:166-204 B:166-204 A:205-243 B:205-243 A:244-282 B:244-282 A:283-320 B:283-320 A:326-364 B:326-364 A:365-403 B:365-403 A:404-442 B:404-442 A:521-559 B:521-559 A:560-588 B:560-588

Biological Unit 1 (1, 11)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HEAT_REPEAT	PS50077	HEAT repeat profile.	2AAA_HUMAN	12-50 89-127 166-204 205-243 244-282 283-320 326-364 365-403 404-442 521-559 560-589	11	A:12-50 - A:89-127 - A:166-204 - A:205-243 - A:244-282 - A:283-320 - A:326-364 - A:365-403 - A:404-442 - A:521-559 - A:560-588 -

Biological Unit 2 (1, 11)

	PROSITE			UniProtKB		PDB
No.	ID	AC	Description	ID	Location	Count	Location
1	HEAT_REPEAT	PS50077	HEAT repeat profile.	2AAA_HUMAN	12-50 89-127 166-204 205-243 244-282 283-320 326-364 365-403 404-442 521-559 560-589	11	- B:12-50 - B:89-127 - B:166-204 - B:205-243 - B:244-282 - B:283-320 - B:326-364 - B:365-403 - B:404-442 - B:521-559 - B:560-588

Asymmetric Unit (15, 30)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1c	ENST00000322088	1c	ENSE00001820117	chr19:52693292-52693427	136	2AAA_HUMAN	1-26	26	2	A:10-26 B:10-26	17 17
1.5d	ENST00000322088	5d	ENSE00001746666	chr19:52705197-52705287	91	2AAA_HUMAN	27-57	31	2	A:27-57 B:27-57	31 31
1.6b	ENST00000322088	6b	ENSE00001693396	chr19:52709216-52709316	101	2AAA_HUMAN	57-90	34	2	A:57-90 B:57-90	34 34
1.7d	ENST00000322088	7d	ENSE00000724168	chr19:52714513-52714745	233	2AAA_HUMAN	91-168	78	2	A:91-168 B:91-168	78 78
1.8b	ENST00000322088	8b	ENSE00000724167	chr19:52715939-52716086	148	2AAA_HUMAN	168-217	50	2	A:168-217 B:168-217	50 50
1.8d	ENST00000322088	8d	ENSE00001673245	chr19:52716208-52716363	156	2AAA_HUMAN	218-269	52	2	A:218-269 B:218-269	52 52
1.9b	ENST00000322088	9b	ENSE00000724163	chr19:52719032-52719146	115	2AAA_HUMAN	270-308	39	2	A:270-308 B:270-308	39 39
1.10	ENST00000322088	10	ENSE00000724161	chr19:52719257-52719327	71	2AAA_HUMAN	308-331	24	2	A:308-331 B:308-331	24 24
1.11	ENST00000322088	11	ENSE00000724160	chr19:52719782-52719916	135	2AAA_HUMAN	332-376	45	2	A:332-376 B:332-376	45 45
1.12b	ENST00000322088	12b	ENSE00001593015	chr19:52722944-52723117	174	2AAA_HUMAN	377-434	58	2	A:377-434 B:377-434	58 58
1.13	ENST00000322088	13	ENSE00000724154	chr19:52723442-52723502	61	2AAA_HUMAN	435-455	21	2	A:435-455 B:435-455	21 21
1.14a	ENST00000322088	14a	ENSE00000724153	chr19:52724232-52724386	155	2AAA_HUMAN	455-506	52	2	A:455-506 B:455-506	52 52
1.15	ENST00000322088	15	ENSE00000724151	chr19:52725352-52725494	143	2AAA_HUMAN	507-554	48	2	A:507-554 B:507-554	48 48
1.16	ENST00000322088	16	ENSE00001282651	chr19:52728970-52729061	92	2AAA_HUMAN	554-585	32	2	A:554-585 B:554-585	32 32
1.17b	ENST00000322088	17b	ENSE00001928382	chr19:52729218-52730687	1470	2AAA_HUMAN	585-589	5	2	A:585-588 B:585-588	4 4

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:579
 aligned with 2AAA_HUMAN | P30153 from UniProtKB/Swiss-Prot  Length:589

    Alignment length:579
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519       529       539       549       559       569       579         
           2AAA_HUMAN    10 LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSL 588
               SCOP domains d2pkga1 A:10-588 Constant regulatory domain of protein phosphatase 2a, pr65alpha                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhh......hhhhhh..hhhhhhh..........hhhhhh...hhhhhhhhhhhh...........hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhh.hhhhhhhhhh....hhhhh..hhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhh..hhhhhh.hhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh...hhhhhhh.hhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------L----------------------------------------------L--W---------------------------------------------------------------------------H------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --HEAT_REPEAT  PDB: A:12-50              --------------------------------------HEAT_REPEAT  PDB: A:89-127             --------------------------------------HEAT_REPEAT  PDB: A:166-204            HEAT_REPEAT  PDB: A:205-243            HEAT_REPEAT  PDB: A:244-282            HEAT_REPEAT  PDB: A:283-320           -----HEAT_REPEAT  PDB: A:326-364            HEAT_REPEAT  PDB: A:365-403            HEAT_REPEAT  PDB: A:404-442            ------------------------------------------------------------------------------HEAT_REPEAT  PDB: A:521-559            HEAT_REPEAT  PDB: A:560-588   PROSITE
           Transcript 1 (1) Exon 1.1c        Exon 1.5d  PDB: A:27-57        ---------------------------------Exon 1.7d  PDB: A:91-168 UniProt: 91-168                                      -------------------------------------------------Exon 1.8d  PDB: A:218-269 UniProt: 218-269          --------------------------------------Exon 1.10  PDB: A:308-33Exon 1.11  PDB: A:332-376 UniProt: 332-376   Exon 1.12b  PDB: A:377-434 UniProt: 377-434               Exon 1.13            ---------------------------------------------------Exon 1.15  PDB: A:507-554 UniProt: 507-554      ------------------------------1.17 Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------Exon 1.6b  PDB: A:57-90           -----------------------------------------------------------------------------Exon 1.8b  PDB: A:168-217 UniProt: 168-217        ----------------------------------------------------Exon 1.9b  PDB: A:270-308              --------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.14a  PDB: A:455-506 UniProt: 455-506         -----------------------------------------------Exon 1.16  PDB: A:554-585       --- Transcript 1 (2)
                 2pkg A  10 LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSL 588
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519       529       539       549       559       569       579

Chain B from PDB  Type:PROTEIN  Length:579
 aligned with 2AAA_HUMAN | P30153 from UniProtKB/Swiss-Prot  Length:589

    Alignment length:579
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519       529       539       549       559       569       579         
           2AAA_HUMAN    10 LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSL 588
               SCOP domains d2pkgb1 B:10-588 Constant regulatory domain of protein phosphatase 2a, pr65alpha                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                                    SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------HEAT-2pkgB01 B:283-313         -------------------------------------------------------------------------------------------------------------------------------------------------------------------------HEAT_2-2pkgB05 B:483-584                                                                              ---- Pfam domains (1)
           Pfam domains (2) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------HEAT-2pkgB02 B:283-313         -------------------------------------------------------------------------------------------------------------------------------------------------------------------------HEAT_2-2pkgB06 B:483-584                                                                              ---- Pfam domains (2)
           Pfam domains (3) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------HEAT-2pkgB03 B:283-313         ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains (3)
           Pfam domains (4) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------HEAT-2pkgB04 B:283-313         ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains (4)
         Sec.struct. author .....hhhhhhh...hhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhh...........hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhh...hhhhhhhh.hhhhhhhhh..hhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------L----------------------------------------------L--W---------------------------------------------------------------------------H------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE --HEAT_REPEAT  PDB: B:12-50              --------------------------------------HEAT_REPEAT  PDB: B:89-127             --------------------------------------HEAT_REPEAT  PDB: B:166-204            HEAT_REPEAT  PDB: B:205-243            HEAT_REPEAT  PDB: B:244-282            HEAT_REPEAT  PDB: B:283-320           -----HEAT_REPEAT  PDB: B:326-364            HEAT_REPEAT  PDB: B:365-403            HEAT_REPEAT  PDB: B:404-442            ------------------------------------------------------------------------------HEAT_REPEAT  PDB: B:521-559            HEAT_REPEAT  PDB: B:560-588   PROSITE
           Transcript 1 (1) Exon 1.1c        Exon 1.5d  PDB: B:27-57        ---------------------------------Exon 1.7d  PDB: B:91-168 UniProt: 91-168                                      -------------------------------------------------Exon 1.8d  PDB: B:218-269 UniProt: 218-269          --------------------------------------Exon 1.10  PDB: B:308-33Exon 1.11  PDB: B:332-376 UniProt: 332-376   Exon 1.12b  PDB: B:377-434 UniProt: 377-434               Exon 1.13            ---------------------------------------------------Exon 1.15  PDB: B:507-554 UniProt: 507-554      ------------------------------1.17 Transcript 1 (1)
           Transcript 1 (2) -----------------------------------------------Exon 1.6b  PDB: B:57-90           -----------------------------------------------------------------------------Exon 1.8b  PDB: B:168-217 UniProt: 168-217        ----------------------------------------------------Exon 1.9b  PDB: B:270-308              --------------------------------------------------------------------------------------------------------------------------------------------------Exon 1.14a  PDB: B:455-506 UniProt: 455-506         -----------------------------------------------Exon 1.16  PDB: B:554-585       --- Transcript 1 (2)
                 2pkg B  10 LYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSL 588
                                    19        29        39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389       399       409       419       429       439       449       459       469       479       489       499       509       519       529       539       549       559       569       579

Chain C from PDB  Type:PROTEIN  Length:80
 aligned with ST_SV40 | P03081 from UniProtKB/Swiss-Prot  Length:174

    Alignment length:80
                                   100       110       120       130       140       150       160       170
              ST_SV40    91 GVDAMYCKQWPECAKKMSANCICLLCLLRMKHENRKLYRKDPLVWVDCYCFDCFRMWFGLDLCEGTLLLWCDIIGQTTYR 170
               SCOP domains d2pkgc1 C:91-170 Small t antigen, ST-AG                                          SCOP domains
               CATH domains -------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ........hhhhhh........hhhhhhhhhhhhhhhhh..........hhhhhhhhhh...hhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------- Transcript
                 2pkg C  91 GVDAMYCKQWPECAKKMSANCICLLCLLRMKHENRKLYRKDPLVWVDCYCFDCFRMWFGLDLCEGTLLLWCDIIGQTTYR 170
                                   100       110       120       130       140       150       160       170

Chain D from PDB  Type:PROTEIN  Length:80
 aligned with ST_SV40 | P03081 from UniProtKB/Swiss-Prot  Length:174

    Alignment length:80
                                   100       110       120       130       140       150       160       170
              ST_SV40    91 GVDAMYCKQWPECAKKMSANCICLLCLLRMKHENRKLYRKDPLVWVDCYCFDCFRMWFGLDLCEGTLLLWCDIIGQTTYR 170
               SCOP domains d2pkgd1 D:91-170 Small t antigen, ST-AG                                          SCOP domains
               CATH domains -------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) Papo_T_antigen-2pkgD01 D:91-170                                                  Pfam domains (1)
           Pfam domains (2) Papo_T_antigen-2pkgD02 D:91-170                                                  Pfam domains (2)
         Sec.struct. author ........hhhhhh........hhhhhhhhhhhhhh.............hhhhhhhhhh...hhhhhhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------- Transcript
                 2pkg D  91 GVDAMYCKQWPECAKKMSANCICLLCLLRMKHENRKLYRKDPLVWVDCYCFDCFRMWFGLDLCEGTLLLWCDIIGQTTYR 170
                                   100       110       120       130       140       150       160       170

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "CATH Domain" information available for 2PKG)

Asymmetric Unit

Clans(

)

Families(

)

Organisms( (-)

)

Clan: TPR (230)

Family: HEAT (7)

Homo sapiens (Human) (5)

1a	HEAT-2pkgB01	B:283-313
1b	HEAT-2pkgB02	B:283-313
1c	HEAT-2pkgB03	B:283-313
1d	HEAT-2pkgB04	B:283-313

Family: HEAT_2 (7)

Homo sapiens (Human) (5)

2a	HEAT_2-2pkgB05	B:483-584
2b	HEAT_2-2pkgB06	B:483-584

Clan: no clan defined [family: Papo_T_antigen] (2)

Family: Papo_T_antigen (2)

Simian virus 40 (SV40) (2)

3a	Papo_T_antigen-2pkgD01	D:91-170
3b	Papo_T_antigen-2pkgD02	D:91-170

Asymmetric Unit(hide GO term definitions)

Chain A,B (2AAA_HUMAN | P30153)

molecular function
	GO:0003823	antigen binding	Interacting selectively and non-covalently with an antigen, any substance which is capable of inducing a specific immune response and of reacting with the products of that response, the specific antibody or specifically sensitized T-lymphocytes, or both. Binding may counteract the biological activity of the antigen.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0046982	protein heterodimerization activity	Interacting selectively and non-covalently with a nonidentical protein to form a heterodimer.
	GO:0004722	protein serine/threonine phosphatase activity	Catalysis of the reaction: protein serine phosphate + H2O = protein serine + phosphate, and protein threonine phosphate + H2O = protein threonine + phosphate.
biological process
	GO:0000086	G2/M transition of mitotic cell cycle	The mitotic cell cycle transition by which a cell in G2 commits to M phase. The process begins when the kinase activity of M cyclin/CDK complex reaches a threshold high enough for the cell cycle to proceed. This is accomplished by activating a positive feedback loop that results in the accumulation of unphosphorylated and active M cyclin/CDK complex.
	GO:0008380	RNA splicing	The process of removing sections of the primary RNA transcript to remove sequences not present in the mature form of the RNA and joining the remaining sections to form the mature form of the RNA.
	GO:0006915	apoptotic process	A programmed cell death process which begins when a cell receives an internal (e.g. DNA damage) or external signal (e.g. an extracellular death ligand), and proceeds through a series of biochemical events (signaling pathway phase) which trigger an execution phase. The execution phase is the last step of an apoptotic process, and is typically characterized by rounding-up of the cell, retraction of pseudopodes, reduction of cellular volume (pyknosis), chromatin condensation, nuclear fragmentation (karyorrhexis), plasma membrane blebbing and fragmentation of the cell into apoptotic bodies. When the execution phase is completed, the cell has died.
	GO:0006672	ceramide metabolic process	The chemical reactions and pathways involving ceramides, any N-acylated sphingoid.
	GO:0007059	chromosome segregation	The process in which genetic material, in the form of chromosomes, is organized into specific structures and then physically separated and apportioned to two or more sets. In eukaryotes, chromosome segregation begins with the condensation of chromosomes, includes chromosome separation, and ends when chromosomes have completed movement to the spindle poles.
	GO:0007143	female meiotic nuclear division	A cell cycle process by which the cell nucleus divides as part of a meiotic cell cycle in the female germline.
	GO:0000188	inactivation of MAPK activity	Any process that terminates the activity of the active enzyme MAP kinase.
	GO:0051754	meiotic sister chromatid cohesion, centromeric	The cell cycle process in which centromeres of sister chromatids are joined during meiosis.
	GO:0051232	meiotic spindle elongation	The lengthening of the distance between poles of the spindle during a meiotic cell cycle.
	GO:0007084	mitotic nuclear envelope reassembly	The cell cycle process that results in reformation of the nuclear envelope during mitotic cell division.
	GO:0051306	mitotic sister chromatid separation	The process in which sister chromatids are physically detached from each other during mitosis.
	GO:0030308	negative regulation of cell growth	Any process that stops, prevents, or reduces the frequency, rate, extent or direction of cell growth.
	GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	The nonsense-mediated decay pathway for nuclear-transcribed mRNAs degrades mRNAs in which an amino-acid codon has changed to a nonsense codon; this prevents the translation of such mRNAs into truncated, and potentially harmful, proteins.
	GO:0070262	peptidyl-serine dephosphorylation	The removal of phosphoric residues from peptidyl-O-phospho-L-serine to form peptidyl-serine.
	GO:2001241	positive regulation of extrinsic apoptotic signaling pathway in absence of ligand	Any process that activates or increases the frequency, rate or extent of extrinsic apoptotic signaling pathway in absence of ligand.
	GO:0006461	protein complex assembly	The aggregation, arrangement and bonding together of a set of components to form a protein complex.
	GO:0006470	protein dephosphorylation	The process of removing one or more phosphoric residues from a protein.
	GO:0006275	regulation of DNA replication	Any process that modulates the frequency, rate or extent of DNA replication.
	GO:0030111	regulation of Wnt signaling pathway	Any process that modulates the frequency, rate or extent of the activity of the Wnt signal transduction pathway.
	GO:0030155	regulation of cell adhesion	Any process that modulates the frequency, rate or extent of attachment of a cell to another cell or to the extracellular matrix.
	GO:0045595	regulation of cell differentiation	Any process that modulates the frequency, rate or extent of cell differentiation, the process in which relatively unspecialized cells acquire specialized structural and functional features.
	GO:0040008	regulation of growth	Any process that modulates the frequency, rate or extent of the growth of all or part of an organism so that it occurs at its proper speed, either globally or in a specific part of the organism's development.
	GO:1903538	regulation of meiotic cell cycle process involved in oocyte maturation	Any process that modulates the frequency, rate or extent of meiotic cell cycle process involved in oocyte maturation.
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0010033	response to organic substance	Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an organic substance stimulus.
	GO:0019932	second-messenger-mediated signaling	Any intracellular signal transduction in which the signal is passed on within the cell via a second messenger; a small molecule or ion that can be quickly generated or released from intracellular stores, and can diffuse within the cell. Second-messenger signaling includes production or release of the second messenger, and effectors downstream of the second messenger that further transmit the signal within the cell.
cellular component
	GO:0005694	chromosome	A structure composed of a very long molecule of DNA and associated proteins (e.g. histones) that carries hereditary information.
	GO:0000775	chromosome, centromeric region	The region of a chromosome that includes the centromeric DNA and associated proteins. In monocentric chromosomes, this region corresponds to a single area of the chromosome, whereas in holocentric chromosomes, it is evenly distributed along the chromosome.
	GO:0005737	cytoplasm	All of the contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.
	GO:0016020	membrane	A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
	GO:0015630	microtubule cytoskeleton	The part of the cytoskeleton (the internal framework of a cell) composed of microtubules and associated proteins.
	GO:0005739	mitochondrion	A semiautonomous, self replicating organelle that occurs in varying numbers, shapes, and sizes in the cytoplasm of virtually all eukaryotic cells. It is notably the site of tissue respiration.
	GO:0005634	nucleus	A membrane-bounded organelle of eukaryotic cells in which chromosomes are housed and replicated. In most cells, the nucleus contains all of the cell's chromosomes except the organellar chromosomes, and is the site of RNA synthesis and processing. In some species, or in specialized cell types, RNA metabolism or DNA replication may be absent.
	GO:0000159	protein phosphatase type 2A complex	A protein complex that has protein serine/threonine phosphatase activity that is polycation-stimulated (PCS), being directly stimulated by protamine, polylysine, or histone H1; it constitutes a subclass of several enzymes activated by different histones and polylysine, and consists of catalytic, scaffolding, and regulatory subunits. The catalytic and scaffolding subunits form the core enzyme, and the holoenzyme also includes the regulatory subunit.

Chain C,D (ST_SV40 | P03081)

molecular function
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
biological process
	GO:0006355	regulation of transcription, DNA-templated	Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
	GO:0039657	suppression by virus of host gene expression	Any process in which a virus stops, prevents, or reduces the frequency, rate or extent of gene expression in the host organism. Gene expression is the process in which a gene's coding sequence is converted into a mature gene product or products (proteins or RNA). This includes the production of an RNA transcript as well as any processing to produce a mature RNA product or an mRNA (for protein-coding genes) and the translation of that mRNA into protein. Some protein processing events may be included when they are required to form an active form of a product from an inactive precursor form.
	GO:0006351	transcription, DNA-templated	The cellular synthesis of RNA on a template of DNA.
	GO:0016032	viral process	A multi-organism process in which a virus is a participant. The other participant is the host. Includes infection of a host cell, replication of the viral genome, and assembly of progeny virus particles. In some cases the viral genetic material may integrate into the host genome and only subsequently, under particular circumstances, 'complete' its life cycle.
cellular component
	GO:0030430	host cell cytoplasm	The cytoplasm of a host cell.
	GO:0042025	host cell nucleus	A membrane-bounded organelle as it is found in the host cell in which chromosomes are housed and replicated. The host is defined as the larger of the organisms involved in a symbiotic interaction.

Asymmetric Unit
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
		ZN	[ RasMol \| Jena3D ]	+environment [ RasMol \| Jena3D ]

	Sites
		AC1	[ RasMol ]	+environment [ RasMol ]
		AC2	[ RasMol ]	+environment [ RasMol ]
		AC3	[ RasMol ]	+environment [ RasMol ]
		AC4	[ RasMol ]	+environment [ RasMol ]

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2pkg)

Biological Units
	Complete Structure
		Biological Unit 1	[ Jena3D ]
		Biological Unit 2	[ Jena3D ]

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ Asym. Unit PNG format \| Asym. Unit - sites PNG format \| Biol. Unit 1 PNG format \| Biol. Unit 1 - sites PNG format \| Biol. Unit 2 PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2pkg
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	2AAA_HUMAN \| P30153
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt
	ST_SV40 \| P03081
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	616362
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	2AAA_HUMAN \| P30153
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)
	ST_SV40 \| P03081
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	2AAA_HUMAN \| P30153	:	1b3u 2ie3 2ie4 2npp 2nyl 2nym 3c5w 3dw8 3k7v 3k7w 4i5l 4i5n 4lac
	ST_SV40 \| P03081	:	2pf4

(no "Related Entries Specified in the PDB File" available for 2PKG)

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 4)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (4, 8)

PROSITE Motifs (1, 22)

Exons (15, 30)

Sequences/Alignments

Classification and Annotation

SCOP Domains (2, 4)

CATH Domains (0, 0)

Pfam Domains (3, 8)

Gene Ontology (46, 48)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File