|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2PD2) |
Sites (0, 0)| (no "Site" information available for 2PD2) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2PD2) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2PD2) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2PD2) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2PD2) |
Exons (0, 0)| (no "Exon" information available for 2PD2) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:108 aligned with Q976P3_SULTO | Q976P3 from UniProtKB/TrEMBL Length:108 Alignment length:108 10 20 30 40 50 60 70 80 90 100 Q976P3_SULTO 1 MKVVVQIKDFDKVPQALRSVINLYNDIKDAEIEVVLHQSAIKALLKDSDTRSIIEDLIKKNILIVGCENSIRSQNLSHDQLIPGIKIVTSGVGEIVRKQSEGWIYLAL 108 SCOP domains d2pd2a_ A: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------ Transcript 2pd2 A 1 MKVVVQIKDFDKVPQALRSVINLYNDIKDAEIEVVLHQSAIKALLKDSDTRSIIEDLIKKNILIVGCENSIRSQNLSHDQLIPGIKIVTSGVGEIVRKQSEGWIYLAL 108 10 20 30 40 50 60 70 80 90 100 Chain B from PDB Type:PROTEIN Length:108 aligned with Q976P3_SULTO | Q976P3 from UniProtKB/TrEMBL Length:108 Alignment length:108 10 20 30 40 50 60 70 80 90 100 Q976P3_SULTO 1 MKVVVQIKDFDKVPQALRSVINLYNDIKDAEIEVVLHQSAIKALLKDSDTRSIIEDLIKKNILIVGCENSIRSQNLSHDQLIPGIKIVTSGVGEIVRKQSEGWIYLAL 108 SCOP domains d2pd2b_ B: automated matches SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains (1) DrsE-2pd2B01 B:1-108 Pfam domains (1) Pfam domains (2) DrsE-2pd2B02 B:1-108 Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------ Transcript 2pd2 B 1 MKVVVQIKDFDKVPQALRSVINLYNDIKDAEIEVVLHQSAIKALLKDSDTRSIIEDLIKKNILIVGCENSIRSQNLSHDQLIPGIKIVTSGVGEIVRKQSEGWIYLAL 108 10 20 30 40 50 60 70 80 90 100
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (0, 0)| (no "CATH Domain" information available for 2PD2) |
Pfam Domains (1, 2)| Asymmetric Unit |
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2PD2)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|