|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric/Biological Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2PCS) |
Cis Peptide Bonds (1, 1)
Asymmetric/Biological Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2PCS) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2PCS) |
Exons (0, 0)| (no "Exon" information available for 2PCS) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:152 aligned with Q5QL47_GEOKA | Q5QL47 from UniProtKB/TrEMBL Length:152 Alignment length:152 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 Q5QL47_GEOKA 1 MNGNGSIELKGTVEEVWSKLMDPSILSKCIMGCKSLELIGEDKYKADLQIGIAAVKGKYDAIIEVTDIKPPYHYKLLVNGEGGPGFVNAEGVIDLTPINDECTQLTYTYSAEVGGKVAAIGQRMLGGVAKLLISDFFKKIQKEIAKSKQEAS 152 SCOP domains d2pcsa1 A:1-147 Hypothetical protein GKP20 ----- SCOP domains CATH domains 2pcsA00 A:1-160 [code=3.30.530.20, no name defined] CATH domains Pfam domains ----COXG-2pcsA01 A:5-145 ------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2pcs A 1 LNGNGSIELKGTVEEVWSKLMDPSILSKCIMGCKSLELIGEDKYKADLQIGIAAVKGKYDAIIEVTDIKPPYHYKLLVNGEGGPGFVNAEGVIDLTPINDECTQLTYTYSAEVGGKVAAIGQRMLGGVAKLLISDFFKKIQKEIAKSHHHHH 160 10 20 30 40 50 60 70 80 90 100 110 120 130 140 |158 147| 156
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric/Biological Unit |
CATH Domains (1, 1)| Asymmetric/Biological Unit |
Pfam Domains (1, 1)| Asymmetric/Biological Unit |
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2PCS)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|