Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF A PUTATIVE PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE BETA-ASPARTATE METHYLTRANSFERASE (PCMT) FROM PLASMODIUM FALCIPARUM IN COMPLEX WITH S-ADENOSYL-L-HOMOCYSTEINE
 
Authors :  A. K. Wernimont, A. Hassanali, L. Lin, J. Lew, Y. Zhao, M. Ravichandran, M. Vedadi, I. Kozieradzki, A. Bochkarev, A. M. Edwards, C. H. Arrowsmi J. Weigelt, M. Sundstrom, R. Hui, W. Qiu, Structural Genomics Conso (Sgc)
Date :  28 Mar 07  (Deposition) - 10 Apr 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym. Unit :  A,B
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Keywords :  Methyltransferase, Protein Repair, Isoaspartyl Formation, P. Falciparum, Structural Genomics Consortium, Sgc, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. K. Wernimont, A. Hassanali, L. Lin, J. Lew, Y. Zhao, M. Ravichandran G. Wasney, M. Vedadi, I. Kozieradzki, A. Bochkarev, A. M. Edwards, C. H. Arrowsmith, J. Weigelt, M. Sundstrom, R. Hui, W. Qiu
Crystal Structure Of A Putative Protein-L-Isoaspartate O-Methyltransferase Beta-Aspartate Methyltransferase (Pcmt) From Plasmodium Falciparum In Complex With S-Adenosyl-L-Homocysteine
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE BETA-ASPARTATE METHYLTRANSFERASE
    Chains: A, B
    EC Number: 2.1.1.77
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: P15-LIC
    Expression System Taxid: 562
    Expression System Vector Type: PLASMID
    Fragment: RESIDUES 15-240
    Gene: PF14_0309
    Organism Scientific: PLASMODIUM FALCIPARUM
    Organism Taxid: 36329
    Strain: 3D7

 Structural Features

(-) Chains, Units

  12
Asymmetric Unit : AB
Biological Unit 1 (1x): A 
Biological Unit 2 (1x):  B

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1SAH2Ligand/IonS-ADENOSYL-L-HOMOCYSTEINE
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1SAH1Ligand/IonS-ADENOSYL-L-HOMOCYSTEINE
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1SAH1Ligand/IonS-ADENOSYL-L-HOMOCYSTEINE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREVAL A:59 , THR A:60 , ILE A:61 , SER A:62 , HIS A:67 , GLY A:88 , SER A:89 , GLY A:90 , SER A:91 , GLU A:116 , ARG A:117 , VAL A:118 , LYS A:147 , ASN A:148 , ILE A:149 , GLY A:169 , VAL A:222 , SER A:223 , LEU A:224 , LYS A:225 , HOH A:305 , HOH A:315 , HOH A:319 , HOH A:379BINDING SITE FOR RESIDUE SAH A 301
2AC2SOFTWAREVAL B:59 , THR B:60 , ILE B:61 , SER B:62 , HIS B:67 , GLY B:88 , SER B:89 , GLY B:90 , SER B:91 , GLU B:116 , ARG B:117 , VAL B:118 , LYS B:147 , ASN B:148 , ILE B:149 , GLY B:169 , VAL B:222 , SER B:223 , LEU B:224 , LYS B:225 , HOH B:307 , HOH B:317 , HOH B:321 , HOH B:379BINDING SITE FOR RESIDUE SAH B 301

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2PBF)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2PBF)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2PBF)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2PBF)

(-) Exons   (0, 0)

(no "Exon" information available for 2PBF)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:218
 aligned with Q8ILD5_PLAF7 | Q8ILD5 from UniProtKB/TrEMBL  Length:240

    Alignment length:219
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231         
         Q8ILD5_PLAF7    22 ENNHKSLLENLKRRGIIDDDDVYNTMLQVDRGKYIKEIPYIDTPVYISHGVTISAPHMHALSLKRLINVLKPGSRAIDVGSGSGYLTVCMAIKMNVLENKNSYVIGLERVKDLVNFSLENIKRDKPELLKIDNFKIIHKNIYQVNEEEKKELGLFDAIHVGASASELPEILVDLLAENGKLIIPIEEDYTQVLYEITKKNGKIIKDRLFDVCFVSLKKN 240
               SCOP domains d2pbfa_ A: automated matches                                                                                                                                                                                                SCOP domains
               CATH domains 2pbfA00 A:9-227 Vaccinia Virus protein VP39                                                                                                                                                                                 CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhh....hhhhhhhhhhhhhhhh..........eeee..eee.hhhhhhhhhhhhh.......eeeee....hhhhhhhhhhh........eeeeee.hhhhhhhhhhhhhhhhhhhhh...eeeee.hhhhhhhhhhhhhh.eeeeee.......hhhhhhheeeeeeeeeeeee..eeeeeeee....-.eeeeeeee........ Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2pbf A   9 ENNHKSLLENLKRRGIIDDDDVYNTMLQVDRGKYIKEIPYIDTPVYISHGVTISAPHMHALSLKRLINVLKPGSRAIDVGSGSGYLTVCMAIKMNVLENKNSYVIGLERVKDLVNFSLENIKRDKPELLKIDNFKIIHKNIYQVNEEEKKELGLFDAIHVGASASELPEILVDLLAENGKLIIPIEEDYTQVLYEITKKNG-IIKDRLFDVCFVSLKKN 227
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208| |    218         
                                                                                                                                                                                                                                  209 |                
                                                                                                                                                                                                                                    211                

Chain B from PDB  Type:PROTEIN  Length:218
 aligned with Q8ILD5_PLAF7 | Q8ILD5 from UniProtKB/TrEMBL  Length:240

    Alignment length:219
                                    31        41        51        61        71        81        91       101       111       121       131       141       151       161       171       181       191       201       211       221       231         
         Q8ILD5_PLAF7    22 ENNHKSLLENLKRRGIIDDDDVYNTMLQVDRGKYIKEIPYIDTPVYISHGVTISAPHMHALSLKRLINVLKPGSRAIDVGSGSGYLTVCMAIKMNVLENKNSYVIGLERVKDLVNFSLENIKRDKPELLKIDNFKIIHKNIYQVNEEEKKELGLFDAIHVGASASELPEILVDLLAENGKLIIPIEEDYTQVLYEITKKNGKIIKDRLFDVCFVSLKKN 240
               SCOP domains d2pbfb_ B: automated matches                                                                                                                                                                                                SCOP domains
               CATH domains 2pbfB00 B:9-227 Vaccinia Virus protein VP39                                                                                                                                                                                 CATH domains
           Pfam domains (1) -PCMT-2pbfB01 B:10-227                                                                                                                                                                                                      Pfam domains (1)
           Pfam domains (2) -PCMT-2pbfB02 B:10-227                                                                                                                                                                                                      Pfam domains (2)
         Sec.struct. author ..hhhhhhhhhhhh....hhhhhhhhhhhhhhhh..........eeee..eee.hhhhhhhhhhhhh.......eeeee....hhhhhhhhhhh........eeeeee.hhhhhhhhhhhhhhhhhhhhhh..eeeee.hhhhhhhhhhhhhh.eeeeee.......hhhhhhheeeeeeeeeeeee..eeeeeeee....-.eeeeeeee........ Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2pbf B   9 ENNHKSLLENLKRRGIIDDDDVYNTMLQVDRGKYIKEIPYIDTPVYISHGVTISAPHMHALSLKRLINVLKPGSRAIDVGSGSGYLTVCMAIKMNVLENKNSYVIGLERVKDLVNFSLENIKRDKPELLKIDNFKIIHKNIYQVNEEEKKELGLFDAIHVGASASELPEILVDLLAENGKLIIPIEEDYTQVLYEITKKNG-IIKDRLFDVCFVSLKKN 227
                                    18        28        38        48        58        68        78        88        98       108       118       128       138       148       158       168       178       188       198       208| |    218         
                                                                                                                                                                                                                                  209 |                
                                                                                                                                                                                                                                    211                

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric Unit

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 2)

Asymmetric Unit

(-) Gene Ontology  (7, 7)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (Q8ILD5_PLAF7 | Q8ILD5)
molecular function
    GO:0008168    methyltransferase activity    Catalysis of the transfer of a methyl group to an acceptor molecule.
    GO:0004719    protein-L-isoaspartate (D-aspartate) O-methyltransferase activity    Catalysis of the reaction: S-adenosyl-L-methionine + protein L-beta-aspartate = S-adenosyl-L-homocysteine + protein L-beta-aspartate methyl ester.
    GO:0016740    transferase activity    Catalysis of the transfer of a group, e.g. a methyl group, glycosyl group, acyl group, phosphorus-containing, or other groups, from one compound (generally regarded as the donor) to another compound (generally regarded as the acceptor). Transferase is the systematic name for any enzyme of EC class 2.
biological process
    GO:0006464    cellular protein modification process    The covalent alteration of one or more amino acids occurring in proteins, peptides and nascent polypeptides (co-translational, post-translational modifications) occurring at the level of an individual cell. Includes the modification of charged tRNAs that are destined to occur in a protein (pre-translation modification).
    GO:0032259    methylation    The process in which a methyl group is covalently attached to a molecule.
    GO:0006479    protein methylation    The addition of a methyl group to a protein amino acid. A methyl group is derived from methane by the removal of a hydrogen atom.
    GO:0030091    protein repair    The process of restoring a protein to its original state after damage by such things as oxidation or spontaneous decomposition of residues.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    SAH  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2pbf)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2pbf
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8ILD5_PLAF7 | Q8ILD5
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.1.1.77
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q8ILD5_PLAF7 | Q8ILD5
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2PBF)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2PBF)