2PAH - JenaLib

Asymmetric Unit (177, 353)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
001	UniProt	VAR_069776	F	121	L	PH4H_HUMAN	Disease (HPA)	---	A/B	F	121	L
002	UniProt	VAR_000893	T	124	I	PH4H_HUMAN	Disease (PKU)	199475571	A/B	T	124	I
003	UniProt	VAR_000894	D	129	Y	PH4H_HUMAN	Disease (PKU)	199475606	A/B	D	129	Y
004	UniProt	VAR_000895	D	143	G	PH4H_HUMAN	Disease (PKU)	199475572	A	D	143	G
005	UniProt	VAR_011566	D	145	V	PH4H_HUMAN	Disease (PKU)	140175796	A/B	D	145	V
006	UniProt	VAR_000896	H	146	Y	PH4H_HUMAN	Disease (PKU)	199475599	A/B	H	146	Y
007	UniProt	VAR_000897	G	148	S	PH4H_HUMAN	Disease (PKU)	80297647	A/B	G	148	S
008	UniProt	VAR_000898	D	151	H	PH4H_HUMAN	Disease (PKU)	199475597	A/B	D	151	H
009	UniProt	VAR_000899	Y	154	N	PH4H_HUMAN	Disease (PKU)	199475587	A/B	Y	154	N
010	UniProt	VAR_009242	R	155	P	PH4H_HUMAN	Disease (PKU)	199475663	A/B	R	155	P
011	UniProt	VAR_000900	R	157	N	PH4H_HUMAN	Disease (PKU)	---	A/B	R	157	N
012	UniProt	VAR_068000	R	157	S	PH4H_HUMAN	Disease (PKU)	199475612	A/B	R	157	S
013	UniProt	VAR_000901	R	158	Q	PH4H_HUMAN	Disease (PKU)	5030843	A/B	R	158	Q
014	UniProt	VAR_000902	R	158	W	PH4H_HUMAN	Disease (PKU)	75166491	A/B	R	158	W
015	UniProt	VAR_000903	Q	160	P	PH4H_HUMAN	Disease (PKU)	199475601	A/B	Q	160	P
016	UniProt	VAR_000904	F	161	S	PH4H_HUMAN	Disease (PKU)	79635844	A/B	F	161	S
017	UniProt	VAR_000905	I	164	T	PH4H_HUMAN	Disease (PKU)	199475595	A/B	I	164	T
018	UniProt	VAR_000906	N	167	I	PH4H_HUMAN	Disease (PKU)	77554925	A/B	N	167	I
019	UniProt	VAR_011567	N	167	S	PH4H_HUMAN	Disease (HPA)	77554925	A/B	N	167	S
020	UniProt	VAR_011568	R	169	H	PH4H_HUMAN	Disease (PKU)	199475679	A/B	R	169	H
021	UniProt	VAR_011569	H	170	D	PH4H_HUMAN	Disease (HPA)	199475655	A/B	H	170	D
022	UniProt	VAR_068001	H	170	Q	PH4H_HUMAN	Disease (PKU)	199475652	A/B	H	170	Q
023	UniProt	VAR_000907	H	170	R	PH4H_HUMAN	Disease (PKU)	199475573	A/B	H	170	R
024	UniProt	VAR_000908	G	171	A	PH4H_HUMAN	Disease (PKU)	199475596	A/B	G	171	A
025	UniProt	VAR_000909	G	171	R	PH4H_HUMAN	Disease (PKU)	199475613	A/B	G	171	R
026	UniProt	VAR_000910	P	173	T	PH4H_HUMAN	Disease (PKU)	199475574	A/B	P	173	T
027	UniProt	VAR_000911	I	174	T	PH4H_HUMAN	Disease (PKU)	138809906	A/B	I	174	T
028	UniProt	VAR_011570	I	174	V	PH4H_HUMAN	Disease (PKU)	199475632	A/B	I	174	V
029	UniProt	VAR_000912	P	175	A	PH4H_HUMAN	Disease (PKU)	199475604	A/B	P	175	A
030	UniProt	VAR_000913	R	176	L	PH4H_HUMAN	Disease (Non-PKU HPA)	74486803	A/B	R	176	L
031	UniProt	VAR_000914	R	176	P	PH4H_HUMAN	Disease (PKU)	74486803	A/B	R	176	P
032	UniProt	VAR_000915	V	177	L	PH4H_HUMAN	Disease (PKU)	199475602	A/B	V	177	L
033	UniProt	VAR_068002	V	177	M	PH4H_HUMAN	Disease (HPA)	199475602	A/B	V	177	M
034	UniProt	VAR_000916	E	178	G	PH4H_HUMAN	Disease (Non-PKU HPA)	77958223	A/B	E	178	G
035	UniProt	VAR_009243	E	183	Q	PH4H_HUMAN	Disease (PKU)	199475664	A/B	E	183	Q
036	UniProt	VAR_000917	V	190	A	PH4H_HUMAN	Disease (PKU)	62514919	A/B	V	190	A
037	UniProt	VAR_000918	L	194	P	PH4H_HUMAN	Disease (PKU)	5030844	A/B	L	194	P
038	UniProt	VAR_069777	S	196	Y	PH4H_HUMAN	Disease (HPA)	---	A/B	S	196	Y
039	UniProt	VAR_000922	H	201	R	PH4H_HUMAN	Disease (PKU)	62517180	A/B	H	201	R
040	UniProt	VAR_000923	H	201	Y	PH4H_HUMAN	Disease (Non-PKU HPA)	62517205	A/B	H	201	Y
041	UniProt	VAR_000924	Y	204	C	PH4H_HUMAN	Disease (PKU)	62514927	A/B	Y	204	C
042	UniProt	VAR_011571	E	205	A	PH4H_HUMAN	Disease (PKU)	62508593	A/B	E	205	A
043	UniProt	VAR_000925	Y	206	D	PH4H_HUMAN	Disease (PKU)	62517170	A/B	Y	206	D
044	UniProt	VAR_000926	N	207	D	PH4H_HUMAN	Disease (PKU)	62508572	A/B	N	207	D
045	UniProt	VAR_000927	N	207	S	PH4H_HUMAN	Disease (PKU)	62508721	A/B	N	207	S
046	UniProt	VAR_000928	P	211	T	PH4H_HUMAN	Disease (PKU)	62514931	A/B	P	211	T
047	UniProt	VAR_000929	L	212	P	PH4H_HUMAN	Disease (PKU)	62517198	A/B	L	212	P
048	UniProt	VAR_000930	L	213	P	PH4H_HUMAN	Disease (PKU)	62516109	A/B	L	213	P
049	UniProt	VAR_000931	C	217	G	PH4H_HUMAN	Disease (PKU)	62508718	A/B	C	217	G
050	UniProt	VAR_000932	G	218	V	PH4H_HUMAN	Disease (PKU)	62514933	A/B	G	218	V
051	UniProt	VAR_000933	E	221	G	PH4H_HUMAN	Disease (PKU)	62514934	A/B	E	221	G
052	UniProt	VAR_000934	D	222	V	PH4H_HUMAN	Disease (PKU)	62507319	A/B	D	222	V
053	UniProt	VAR_000935	I	224	M	PH4H_HUMAN	Disease (PKU)	199475576	A/B	I	224	M
054	UniProt	VAR_000936	P	225	R	PH4H_HUMAN	Disease (PKU)	62517204	A/B	P	225	R
055	UniProt	VAR_000937	P	225	T	PH4H_HUMAN	Disease (PKU)	199475589	A/B	P	225	T
056	UniProt	VAR_068003	Q	226	H	PH4H_HUMAN	Disease (PKU)	62508615	A/B	Q	226	H
057	UniProt	VAR_000938	V	230	I	PH4H_HUMAN	Disease (Non-PKU HPA)	62516152	A/B	V	230	I
058	UniProt	VAR_009244	S	231	F	PH4H_HUMAN	Disease (PKU)	62508577	A/B	S	231	F
059	UniProt	VAR_000939	S	231	P	PH4H_HUMAN	Disease (PKU)	5030845	A/B	S	231	P
060	UniProt	VAR_000940	F	233	L	PH4H_HUMAN	Disease (PKU)	62517208	A/B	F	233	L
061	UniProt	VAR_000941	T	238	P	PH4H_HUMAN	Disease (PKU)	199475577	A/B	T	238	P
062	UniProt	VAR_000942	G	239	S	PH4H_HUMAN	Disease (PKU)	62517178	A/B	G	239	S
063	UniProt	VAR_011572	F	240	S	PH4H_HUMAN	Disease (PKU)	62508594	A/B	F	240	S
064	UniProt	VAR_000943	R	241	C	PH4H_HUMAN	Disease (PKU)	76687508	A/B	R	241	C
065	UniProt	VAR_000944	R	241	H	PH4H_HUMAN	Disease (PKU)	62508730	A/B	R	241	H
066	UniProt	VAR_000945	R	241	L	PH4H_HUMAN	Disease (PKU)	62508730	A/B	R	241	L
067	UniProt	VAR_000946	L	242	F	PH4H_HUMAN	Disease (PKU)	199475578	A/B	L	242	F
068	UniProt	VAR_000947	R	243	Q	PH4H_HUMAN	Disease (PKU)	62508588	A/B	R	243	Q
069	UniProt	VAR_000948	P	244	L	PH4H_HUMAN	Disease (PKU)	118203923	A/B	P	244	L
070	UniProt	VAR_000949	V	245	A	PH4H_HUMAN	Disease (PKU)	796052017	A/B	V	245	A
071	UniProt	VAR_000950	V	245	E	PH4H_HUMAN	Disease (PKU)	76212747	A/B	V	245	E
072	UniProt	VAR_000951	V	245	L	PH4H_HUMAN	Disease (PKU)	62508694	A/B	V	245	L
073	UniProt	VAR_000952	A	246	D	PH4H_HUMAN	Disease (PKU)	199475610	A/B	A	246	D
074	UniProt	VAR_000953	G	247	V	PH4H_HUMAN	Disease (PKU)	199475579	A/B	G	247	V
075	UniProt	VAR_000954	L	248	P	PH4H_HUMAN	Disease (PKU)	62507340	A/B	L	248	P
076	UniProt	VAR_000955	L	249	F	PH4H_HUMAN	Disease (PKU)	74503222	A/B	L	249	F
077	UniProt	VAR_000956	R	252	G	PH4H_HUMAN	Disease (PKU)	5030847	A/B	R	252	G
078	UniProt	VAR_000957	R	252	Q	PH4H_HUMAN	Disease (PKU)	62644503	A/B	R	252	Q
079	UniProt	VAR_000958	R	252	W	PH4H_HUMAN	Disease (PKU)	5030847	A/B	R	252	W
080	UniProt	VAR_000960	L	255	S	PH4H_HUMAN	Disease (PKU)	62642930	A/B	L	255	S
081	UniProt	VAR_000959	L	255	V	PH4H_HUMAN	Disease (PKU)	62642931	A/B	L	255	V
082	UniProt	VAR_000961	G	257	C	PH4H_HUMAN	Disease (PKU)	5030848	A/B	G	257	C
083	UniProt	VAR_000962	A	259	T	PH4H_HUMAN	Disease (PKU)	62642932	A/B	A	259	T
084	UniProt	VAR_000963	A	259	V	PH4H_HUMAN	Disease (PKU)	118203921	A/B	A	259	V
085	UniProt	VAR_000964	R	261	P	PH4H_HUMAN	Disease (PKU)	5030849	A/B	R	261	P
086	UniProt	VAR_000965	R	261	Q	PH4H_HUMAN	Disease (PKU)	5030849	A/B	R	261	Q
087	UniProt	VAR_000966	F	263	L	PH4H_HUMAN	Disease (PKU)	62642944	A/B	F	263	L
088	UniProt	VAR_000967	H	264	L	PH4H_HUMAN	Disease (PKU)	199475580	A/B	H	264	L
089	UniProt	VAR_000968	C	265	G	PH4H_HUMAN	Disease (PKU)	62517181	A/B	C	265	G
090	UniProt	VAR_000969	I	269	L	PH4H_HUMAN	Disease (Non-PKU HPA)	62508692	A/B	I	269	L
091	UniProt	VAR_000970	R	270	K	PH4H_HUMAN	Disease (PKU)	62514950	A/B	R	270	K
092	UniProt	VAR_000971	R	270	S	PH4H_HUMAN	Disease (PKU)	62514951	A/B	R	270	S
093	UniProt	VAR_000972	H	271	Y	PH4H_HUMAN	Disease (PKU)	62517164	A/B	H	271	Y
094	UniProt	VAR_000973	S	273	F	PH4H_HUMAN	Disease (PKU)	62514953	A/B	S	273	F
095	UniProt	VAR_011573	K	274	E	PH4H_HUMAN	Polymorphism	142934616	A/B	K	274	E
096	UniProt	VAR_068004	P	275	L	PH4H_HUMAN	Disease (PKU)	62508715	A/B	P	275	L
097	UniProt	VAR_000974	M	276	I	PH4H_HUMAN	Disease (PKU)	62514954	A/B	M	276	I
098	UniProt	VAR_000975	M	276	V	PH4H_HUMAN	Disease (PKU)	62516149	A/B	M	276	V
099	UniProt	VAR_000976	Y	277	C	PH4H_HUMAN	Disease (PKU)	62516155	A/B	Y	277	C
100	UniProt	VAR_000977	Y	277	D	PH4H_HUMAN	Disease (PKU)	78655458	A/B	Y	277	D
101	UniProt	VAR_000978	T	278	A	PH4H_HUMAN	Disease (PKU)	62516156	A/B	T	278	A
102	UniProt	VAR_000979	T	278	N	PH4H_HUMAN	Disease (PKU)	62507262	A/B	T	278	N
103	UniProt	VAR_000980	E	280	K	PH4H_HUMAN	Disease (PKU)	62508698	A/B	E	280	K
104	UniProt	VAR_000981	P	281	L	PH4H_HUMAN	Disease (PKU)	5030851	A/B	P	281	L
105	UniProt	VAR_000982	D	282	N	PH4H_HUMAN	Disease (PKU)	199475582	A/B	D	282	N
106	UniProt	VAR_000983	I	283	F	PH4H_HUMAN	Disease (PKU)	62517168	A/B	I	283	F
107	UniProt	VAR_000984	I	283	N	PH4H_HUMAN	Disease (PKU)	62508693	A/B	I	283	N
108	UniProt	VAR_067758	H	290	Y	PH4H_HUMAN	Disease (PKU)	---	A/B	H	290	Y
109	UniProt	VAR_000985	R	297	C	PH4H_HUMAN	Disease (PKU)	62642945	A/B	R	297	C
110	UniProt	VAR_000986	R	297	H	PH4H_HUMAN	Disease (PKU)	62642939	A/B	R	297	H
111	UniProt	VAR_000987	F	299	C	PH4H_HUMAN	Disease (PKU)	62642933	A/B	F	299	C
112	UniProt	VAR_000988	A	300	S	PH4H_HUMAN	Disease (PKU)	5030853	A/B	A	300	S
113	UniProt	VAR_000989	A	300	V	PH4H_HUMAN	Disease (PKU)	199475609	A/B	A	300	V
114	UniProt	VAR_000990	S	303	P	PH4H_HUMAN	Disease (PKU)	199475608	A/B	S	303	P
115	UniProt	VAR_000991	Q	304	R	PH4H_HUMAN	Disease (PKU)	199475592	A/B	Q	304	R
116	UniProt	VAR_000992	I	306	V	PH4H_HUMAN	Disease (Non-PKU HPA)	62642934	A/B	I	306	V
117	UniProt	VAR_000993	A	309	D	PH4H_HUMAN	Disease (PKU)	62642935	A/B	A	309	D
118	UniProt	VAR_000994	A	309	V	PH4H_HUMAN	Disease (PKU)	62642935	A/B	A	309	V
119	UniProt	VAR_000995	S	310	F	PH4H_HUMAN	Disease (PKU)	62642913	A/B	S	310	F
120	UniProt	VAR_068005	S	310	Y	PH4H_HUMAN	Disease (HPA)	62642913	A/B	S	310	Y
121	UniProt	VAR_000996	L	311	P	PH4H_HUMAN	Disease (PKU)	62642936	A/B	L	311	P
122	UniProt	VAR_000997	P	314	H	PH4H_HUMAN	Disease (PKU)	62642940	A/B	P	314	H
123	UniProt	VAR_068006	P	314	S	PH4H_HUMAN	Disease (HPA)	199475650	A/B	P	314	S
124	UniProt	VAR_011574	I	318	T	PH4H_HUMAN	Disease (PKU)	62642918	A/B	I	318	T
125	UniProt	VAR_000998	A	322	G	PH4H_HUMAN	Disease (PKU)	62514958	A/B	A	322	G
126	UniProt	VAR_000999	A	322	T	PH4H_HUMAN	Disease (PKU)	62514957	A/B	A	322	T
127	UniProt	VAR_067759	A	322	V	PH4H_HUMAN	Disease (PKU)	---	A/B	A	322	V
128	UniProt	VAR_009245	Y	325	C	PH4H_HUMAN	Disease (PKU)	62508578	A/B	Y	325	C
129	UniProt	VAR_009246	E	330	D	PH4H_HUMAN	Disease (PKU)	62508580	A/B	E	330	D
130	UniProt	VAR_001000	F	331	L	PH4H_HUMAN	Disease (PKU)	62517179	A/B	F	331	L
131	UniProt	VAR_001001	L	333	F	PH4H_HUMAN	Disease (PKU)	62516060	A/B	L	333	F
132	UniProt	VAR_001002	C	334	S	PH4H_HUMAN	Disease (PKU)	62517174	A/B	C	334	S
133	UniProt	VAR_001003	G	337	V	PH4H_HUMAN	Disease (PKU)	62517206	A/B	G	337	V
134	UniProt	VAR_001004	D	338	Y	PH4H_HUMAN	Disease (PKU)	62516150	A/B	D	338	Y
135	UniProt	VAR_001005	K	341	R	PH4H_HUMAN	Disease (PKU)	62516153	A/B	K	341	R
136	UniProt	VAR_001006	K	341	T	PH4H_HUMAN	Disease (PKU)	62516153	A/B	K	341	T
137	UniProt	VAR_001007	A	342	T	PH4H_HUMAN	Disease (PKU)	62507282	A/B	A	342	T
138	UniProt	VAR_001008	Y	343	C	PH4H_HUMAN	Disease (PKU)	62507265	A/B	Y	343	C
139	UniProt	VAR_009247	G	344	R	PH4H_HUMAN	Disease (PKU)	62508679	A/B	G	344	R
140	UniProt	VAR_009248	G	344	V	PH4H_HUMAN	Disease (PKU)	62508582	A/B	G	344	V
141	UniProt	VAR_001009	A	345	S	PH4H_HUMAN	Disease (PKU)	62516062	A/B	A	345	S
142	UniProt	VAR_001010	A	345	T	PH4H_HUMAN	Disease (PKU)	62516062	A/B	A	345	T
143	UniProt	VAR_001011	L	347	F	PH4H_HUMAN	Disease (PKU)	62516154	A/B	L	347	F
144	UniProt	VAR_001012	L	348	V	PH4H_HUMAN	Disease (PKU)	62516092	A/B	L	348	V
145	UniProt	VAR_001013	S	349	L	PH4H_HUMAN	Disease (PKU)	62507279	A/B	S	349	L
146	UniProt	VAR_001014	S	349	P	PH4H_HUMAN	Disease (PKU)	62508646	A/B	S	349	P
147	UniProt	VAR_001015	S	350	T	PH4H_HUMAN	Disease (PKU)	62517183	A/B	S	350	T
148	UniProt	VAR_011575	C	357	G	PH4H_HUMAN	Disease (PKU)	62508595	A/B	C	357	G
149	UniProt	VAR_001016	P	362	T	PH4H_HUMAN	Disease (PKU)	62507329	A/B	P	362	T
150	UniProt	VAR_001019	P	366	H	PH4H_HUMAN	Disease (PKU)	62516098	A/B	P	366	H
151	UniProt	VAR_001020	T	372	S	PH4H_HUMAN	Disease (PKU)	62517163	A/B	T	372	S
152	UniProt	VAR_001021	Y	377	C	PH4H_HUMAN	Disease (PKU)	62642942	A/B	Y	377	C
153	UniProt	VAR_001022	T	380	M	PH4H_HUMAN	Disease (Non-PKU HPA)	62642937	A/B	T	380	M
154	UniProt	VAR_001023	Y	386	C	PH4H_HUMAN	Disease (PKU)	62516141	A/B	Y	386	C
155	UniProt	VAR_001024	Y	387	H	PH4H_HUMAN	Disease (PKU)	62517194	A/B	Y	387	H
156	UniProt	VAR_001025	V	388	L	PH4H_HUMAN	Disease (PKU)	62516101	A/B	V	388	L
157	UniProt	VAR_001026	V	388	M	PH4H_HUMAN	Disease (PKU)	62516101	A/B	V	388	M
158	UniProt	VAR_001027	E	390	G	PH4H_HUMAN	Disease (PKU)	5030856	A/B	E	390	G
159	UniProt	VAR_001028	D	394	A	PH4H_HUMAN	Disease (PKU)	62516102	A/B	D	394	A
160	UniProt	VAR_001029	D	394	H	PH4H_HUMAN	Disease (PKU)	62516142	A/B	D	394	H
161	UniProt	VAR_001030	A	395	G	PH4H_HUMAN	Disease (PKU)	62508736	A/B	A	395	G
162	UniProt	VAR_001031	A	395	P	PH4H_HUMAN	Disease (PKU)	62516103	A/B	A	395	P
163	UniProt	VAR_001033	A	403	V	PH4H_HUMAN	Disease (PKU)	5030857	A/B	A	403	V
164	UniProt	VAR_068007	P	407	L	PH4H_HUMAN	Disease (PKU)	62644473	A/B	P	407	L
165	UniProt	VAR_011576	P	407	S	PH4H_HUMAN	Disease (PKU)	62644465	A/B	P	407	S
166	UniProt	VAR_001034	R	408	Q	PH4H_HUMAN	Disease (PKU)	5030859	A/B	R	408	Q
167	UniProt	VAR_001035	R	408	W	PH4H_HUMAN	Disease (PKU)	5030858	A/B	R	408	W
168	UniProt	VAR_009249	F	410	S	PH4H_HUMAN	Disease (PKU)	62644475	A/B	F	410	S
169	UniProt	VAR_001036	R	413	P	PH4H_HUMAN	Disease (PKU)	79931499	A/B	R	413	P
170	UniProt	VAR_001037	R	413	S	PH4H_HUMAN	Disease (PKU)	62644467	A/B	R	413	S
171	UniProt	VAR_001038	Y	414	C	PH4H_HUMAN	Disease (PKU)	5030860	A/B	Y	414	C
172	UniProt	VAR_001039	D	415	N	PH4H_HUMAN	Disease (PKU)	62644499	A/B	D	415	N
173	UniProt	VAR_068008	Y	417	H	PH4H_HUMAN	Disease (PKU)	62644471	A/B	Y	417	H
174	UniProt	VAR_001040	T	418	P	PH4H_HUMAN	Disease (PKU)	62644501	A/B	T	418	P
175	UniProt	VAR_067760	I	421	S	PH4H_HUMAN	Disease (PKU)	---	A/B	I	421	S
176	UniProt	VAR_001041	L	430	P	PH4H_HUMAN	Disease (PKU)	199475607	A/B	L	430	P
177	UniProt	VAR_001042	A	447	D	PH4H_HUMAN	Disease (PKU)	76542238	A/B	A	447	D

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

Biological Unit 1 (177, 706)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
001	UniProt	VAR_069776	F	121	L	PH4H_HUMAN	Disease (HPA)	---	A/B	F	121	L
002	UniProt	VAR_000893	T	124	I	PH4H_HUMAN	Disease (PKU)	199475571	A/B	T	124	I
003	UniProt	VAR_000894	D	129	Y	PH4H_HUMAN	Disease (PKU)	199475606	A/B	D	129	Y
004	UniProt	VAR_000895	D	143	G	PH4H_HUMAN	Disease (PKU)	199475572	A	D	143	G
005	UniProt	VAR_011566	D	145	V	PH4H_HUMAN	Disease (PKU)	140175796	A/B	D	145	V
006	UniProt	VAR_000896	H	146	Y	PH4H_HUMAN	Disease (PKU)	199475599	A/B	H	146	Y
007	UniProt	VAR_000897	G	148	S	PH4H_HUMAN	Disease (PKU)	80297647	A/B	G	148	S
008	UniProt	VAR_000898	D	151	H	PH4H_HUMAN	Disease (PKU)	199475597	A/B	D	151	H
009	UniProt	VAR_000899	Y	154	N	PH4H_HUMAN	Disease (PKU)	199475587	A/B	Y	154	N
010	UniProt	VAR_009242	R	155	P	PH4H_HUMAN	Disease (PKU)	199475663	A/B	R	155	P
011	UniProt	VAR_000900	R	157	N	PH4H_HUMAN	Disease (PKU)	---	A/B	R	157	N
012	UniProt	VAR_068000	R	157	S	PH4H_HUMAN	Disease (PKU)	199475612	A/B	R	157	S
013	UniProt	VAR_000901	R	158	Q	PH4H_HUMAN	Disease (PKU)	5030843	A/B	R	158	Q
014	UniProt	VAR_000902	R	158	W	PH4H_HUMAN	Disease (PKU)	75166491	A/B	R	158	W
015	UniProt	VAR_000903	Q	160	P	PH4H_HUMAN	Disease (PKU)	199475601	A/B	Q	160	P
016	UniProt	VAR_000904	F	161	S	PH4H_HUMAN	Disease (PKU)	79635844	A/B	F	161	S
017	UniProt	VAR_000905	I	164	T	PH4H_HUMAN	Disease (PKU)	199475595	A/B	I	164	T
018	UniProt	VAR_000906	N	167	I	PH4H_HUMAN	Disease (PKU)	77554925	A/B	N	167	I
019	UniProt	VAR_011567	N	167	S	PH4H_HUMAN	Disease (HPA)	77554925	A/B	N	167	S
020	UniProt	VAR_011568	R	169	H	PH4H_HUMAN	Disease (PKU)	199475679	A/B	R	169	H
021	UniProt	VAR_011569	H	170	D	PH4H_HUMAN	Disease (HPA)	199475655	A/B	H	170	D
022	UniProt	VAR_068001	H	170	Q	PH4H_HUMAN	Disease (PKU)	199475652	A/B	H	170	Q
023	UniProt	VAR_000907	H	170	R	PH4H_HUMAN	Disease (PKU)	199475573	A/B	H	170	R
024	UniProt	VAR_000908	G	171	A	PH4H_HUMAN	Disease (PKU)	199475596	A/B	G	171	A
025	UniProt	VAR_000909	G	171	R	PH4H_HUMAN	Disease (PKU)	199475613	A/B	G	171	R
026	UniProt	VAR_000910	P	173	T	PH4H_HUMAN	Disease (PKU)	199475574	A/B	P	173	T
027	UniProt	VAR_000911	I	174	T	PH4H_HUMAN	Disease (PKU)	138809906	A/B	I	174	T
028	UniProt	VAR_011570	I	174	V	PH4H_HUMAN	Disease (PKU)	199475632	A/B	I	174	V
029	UniProt	VAR_000912	P	175	A	PH4H_HUMAN	Disease (PKU)	199475604	A/B	P	175	A
030	UniProt	VAR_000913	R	176	L	PH4H_HUMAN	Disease (Non-PKU HPA)	74486803	A/B	R	176	L
031	UniProt	VAR_000914	R	176	P	PH4H_HUMAN	Disease (PKU)	74486803	A/B	R	176	P
032	UniProt	VAR_000915	V	177	L	PH4H_HUMAN	Disease (PKU)	199475602	A/B	V	177	L
033	UniProt	VAR_068002	V	177	M	PH4H_HUMAN	Disease (HPA)	199475602	A/B	V	177	M
034	UniProt	VAR_000916	E	178	G	PH4H_HUMAN	Disease (Non-PKU HPA)	77958223	A/B	E	178	G
035	UniProt	VAR_009243	E	183	Q	PH4H_HUMAN	Disease (PKU)	199475664	A/B	E	183	Q
036	UniProt	VAR_000917	V	190	A	PH4H_HUMAN	Disease (PKU)	62514919	A/B	V	190	A
037	UniProt	VAR_000918	L	194	P	PH4H_HUMAN	Disease (PKU)	5030844	A/B	L	194	P
038	UniProt	VAR_069777	S	196	Y	PH4H_HUMAN	Disease (HPA)	---	A/B	S	196	Y
039	UniProt	VAR_000922	H	201	R	PH4H_HUMAN	Disease (PKU)	62517180	A/B	H	201	R
040	UniProt	VAR_000923	H	201	Y	PH4H_HUMAN	Disease (Non-PKU HPA)	62517205	A/B	H	201	Y
041	UniProt	VAR_000924	Y	204	C	PH4H_HUMAN	Disease (PKU)	62514927	A/B	Y	204	C
042	UniProt	VAR_011571	E	205	A	PH4H_HUMAN	Disease (PKU)	62508593	A/B	E	205	A
043	UniProt	VAR_000925	Y	206	D	PH4H_HUMAN	Disease (PKU)	62517170	A/B	Y	206	D
044	UniProt	VAR_000926	N	207	D	PH4H_HUMAN	Disease (PKU)	62508572	A/B	N	207	D
045	UniProt	VAR_000927	N	207	S	PH4H_HUMAN	Disease (PKU)	62508721	A/B	N	207	S
046	UniProt	VAR_000928	P	211	T	PH4H_HUMAN	Disease (PKU)	62514931	A/B	P	211	T
047	UniProt	VAR_000929	L	212	P	PH4H_HUMAN	Disease (PKU)	62517198	A/B	L	212	P
048	UniProt	VAR_000930	L	213	P	PH4H_HUMAN	Disease (PKU)	62516109	A/B	L	213	P
049	UniProt	VAR_000931	C	217	G	PH4H_HUMAN	Disease (PKU)	62508718	A/B	C	217	G
050	UniProt	VAR_000932	G	218	V	PH4H_HUMAN	Disease (PKU)	62514933	A/B	G	218	V
051	UniProt	VAR_000933	E	221	G	PH4H_HUMAN	Disease (PKU)	62514934	A/B	E	221	G
052	UniProt	VAR_000934	D	222	V	PH4H_HUMAN	Disease (PKU)	62507319	A/B	D	222	V
053	UniProt	VAR_000935	I	224	M	PH4H_HUMAN	Disease (PKU)	199475576	A/B	I	224	M
054	UniProt	VAR_000936	P	225	R	PH4H_HUMAN	Disease (PKU)	62517204	A/B	P	225	R
055	UniProt	VAR_000937	P	225	T	PH4H_HUMAN	Disease (PKU)	199475589	A/B	P	225	T
056	UniProt	VAR_068003	Q	226	H	PH4H_HUMAN	Disease (PKU)	62508615	A/B	Q	226	H
057	UniProt	VAR_000938	V	230	I	PH4H_HUMAN	Disease (Non-PKU HPA)	62516152	A/B	V	230	I
058	UniProt	VAR_009244	S	231	F	PH4H_HUMAN	Disease (PKU)	62508577	A/B	S	231	F
059	UniProt	VAR_000939	S	231	P	PH4H_HUMAN	Disease (PKU)	5030845	A/B	S	231	P
060	UniProt	VAR_000940	F	233	L	PH4H_HUMAN	Disease (PKU)	62517208	A/B	F	233	L
061	UniProt	VAR_000941	T	238	P	PH4H_HUMAN	Disease (PKU)	199475577	A/B	T	238	P
062	UniProt	VAR_000942	G	239	S	PH4H_HUMAN	Disease (PKU)	62517178	A/B	G	239	S
063	UniProt	VAR_011572	F	240	S	PH4H_HUMAN	Disease (PKU)	62508594	A/B	F	240	S
064	UniProt	VAR_000943	R	241	C	PH4H_HUMAN	Disease (PKU)	76687508	A/B	R	241	C
065	UniProt	VAR_000944	R	241	H	PH4H_HUMAN	Disease (PKU)	62508730	A/B	R	241	H
066	UniProt	VAR_000945	R	241	L	PH4H_HUMAN	Disease (PKU)	62508730	A/B	R	241	L
067	UniProt	VAR_000946	L	242	F	PH4H_HUMAN	Disease (PKU)	199475578	A/B	L	242	F
068	UniProt	VAR_000947	R	243	Q	PH4H_HUMAN	Disease (PKU)	62508588	A/B	R	243	Q
069	UniProt	VAR_000948	P	244	L	PH4H_HUMAN	Disease (PKU)	118203923	A/B	P	244	L
070	UniProt	VAR_000949	V	245	A	PH4H_HUMAN	Disease (PKU)	796052017	A/B	V	245	A
071	UniProt	VAR_000950	V	245	E	PH4H_HUMAN	Disease (PKU)	76212747	A/B	V	245	E
072	UniProt	VAR_000951	V	245	L	PH4H_HUMAN	Disease (PKU)	62508694	A/B	V	245	L
073	UniProt	VAR_000952	A	246	D	PH4H_HUMAN	Disease (PKU)	199475610	A/B	A	246	D
074	UniProt	VAR_000953	G	247	V	PH4H_HUMAN	Disease (PKU)	199475579	A/B	G	247	V
075	UniProt	VAR_000954	L	248	P	PH4H_HUMAN	Disease (PKU)	62507340	A/B	L	248	P
076	UniProt	VAR_000955	L	249	F	PH4H_HUMAN	Disease (PKU)	74503222	A/B	L	249	F
077	UniProt	VAR_000956	R	252	G	PH4H_HUMAN	Disease (PKU)	5030847	A/B	R	252	G
078	UniProt	VAR_000957	R	252	Q	PH4H_HUMAN	Disease (PKU)	62644503	A/B	R	252	Q
079	UniProt	VAR_000958	R	252	W	PH4H_HUMAN	Disease (PKU)	5030847	A/B	R	252	W
080	UniProt	VAR_000960	L	255	S	PH4H_HUMAN	Disease (PKU)	62642930	A/B	L	255	S
081	UniProt	VAR_000959	L	255	V	PH4H_HUMAN	Disease (PKU)	62642931	A/B	L	255	V
082	UniProt	VAR_000961	G	257	C	PH4H_HUMAN	Disease (PKU)	5030848	A/B	G	257	C
083	UniProt	VAR_000962	A	259	T	PH4H_HUMAN	Disease (PKU)	62642932	A/B	A	259	T
084	UniProt	VAR_000963	A	259	V	PH4H_HUMAN	Disease (PKU)	118203921	A/B	A	259	V
085	UniProt	VAR_000964	R	261	P	PH4H_HUMAN	Disease (PKU)	5030849	A/B	R	261	P
086	UniProt	VAR_000965	R	261	Q	PH4H_HUMAN	Disease (PKU)	5030849	A/B	R	261	Q
087	UniProt	VAR_000966	F	263	L	PH4H_HUMAN	Disease (PKU)	62642944	A/B	F	263	L
088	UniProt	VAR_000967	H	264	L	PH4H_HUMAN	Disease (PKU)	199475580	A/B	H	264	L
089	UniProt	VAR_000968	C	265	G	PH4H_HUMAN	Disease (PKU)	62517181	A/B	C	265	G
090	UniProt	VAR_000969	I	269	L	PH4H_HUMAN	Disease (Non-PKU HPA)	62508692	A/B	I	269	L
091	UniProt	VAR_000970	R	270	K	PH4H_HUMAN	Disease (PKU)	62514950	A/B	R	270	K
092	UniProt	VAR_000971	R	270	S	PH4H_HUMAN	Disease (PKU)	62514951	A/B	R	270	S
093	UniProt	VAR_000972	H	271	Y	PH4H_HUMAN	Disease (PKU)	62517164	A/B	H	271	Y
094	UniProt	VAR_000973	S	273	F	PH4H_HUMAN	Disease (PKU)	62514953	A/B	S	273	F
095	UniProt	VAR_011573	K	274	E	PH4H_HUMAN	Polymorphism	142934616	A/B	K	274	E
096	UniProt	VAR_068004	P	275	L	PH4H_HUMAN	Disease (PKU)	62508715	A/B	P	275	L
097	UniProt	VAR_000974	M	276	I	PH4H_HUMAN	Disease (PKU)	62514954	A/B	M	276	I
098	UniProt	VAR_000975	M	276	V	PH4H_HUMAN	Disease (PKU)	62516149	A/B	M	276	V
099	UniProt	VAR_000976	Y	277	C	PH4H_HUMAN	Disease (PKU)	62516155	A/B	Y	277	C
100	UniProt	VAR_000977	Y	277	D	PH4H_HUMAN	Disease (PKU)	78655458	A/B	Y	277	D
101	UniProt	VAR_000978	T	278	A	PH4H_HUMAN	Disease (PKU)	62516156	A/B	T	278	A
102	UniProt	VAR_000979	T	278	N	PH4H_HUMAN	Disease (PKU)	62507262	A/B	T	278	N
103	UniProt	VAR_000980	E	280	K	PH4H_HUMAN	Disease (PKU)	62508698	A/B	E	280	K
104	UniProt	VAR_000981	P	281	L	PH4H_HUMAN	Disease (PKU)	5030851	A/B	P	281	L
105	UniProt	VAR_000982	D	282	N	PH4H_HUMAN	Disease (PKU)	199475582	A/B	D	282	N
106	UniProt	VAR_000983	I	283	F	PH4H_HUMAN	Disease (PKU)	62517168	A/B	I	283	F
107	UniProt	VAR_000984	I	283	N	PH4H_HUMAN	Disease (PKU)	62508693	A/B	I	283	N
108	UniProt	VAR_067758	H	290	Y	PH4H_HUMAN	Disease (PKU)	---	A/B	H	290	Y
109	UniProt	VAR_000985	R	297	C	PH4H_HUMAN	Disease (PKU)	62642945	A/B	R	297	C
110	UniProt	VAR_000986	R	297	H	PH4H_HUMAN	Disease (PKU)	62642939	A/B	R	297	H
111	UniProt	VAR_000987	F	299	C	PH4H_HUMAN	Disease (PKU)	62642933	A/B	F	299	C
112	UniProt	VAR_000988	A	300	S	PH4H_HUMAN	Disease (PKU)	5030853	A/B	A	300	S
113	UniProt	VAR_000989	A	300	V	PH4H_HUMAN	Disease (PKU)	199475609	A/B	A	300	V
114	UniProt	VAR_000990	S	303	P	PH4H_HUMAN	Disease (PKU)	199475608	A/B	S	303	P
115	UniProt	VAR_000991	Q	304	R	PH4H_HUMAN	Disease (PKU)	199475592	A/B	Q	304	R
116	UniProt	VAR_000992	I	306	V	PH4H_HUMAN	Disease (Non-PKU HPA)	62642934	A/B	I	306	V
117	UniProt	VAR_000993	A	309	D	PH4H_HUMAN	Disease (PKU)	62642935	A/B	A	309	D
118	UniProt	VAR_000994	A	309	V	PH4H_HUMAN	Disease (PKU)	62642935	A/B	A	309	V
119	UniProt	VAR_000995	S	310	F	PH4H_HUMAN	Disease (PKU)	62642913	A/B	S	310	F
120	UniProt	VAR_068005	S	310	Y	PH4H_HUMAN	Disease (HPA)	62642913	A/B	S	310	Y
121	UniProt	VAR_000996	L	311	P	PH4H_HUMAN	Disease (PKU)	62642936	A/B	L	311	P
122	UniProt	VAR_000997	P	314	H	PH4H_HUMAN	Disease (PKU)	62642940	A/B	P	314	H
123	UniProt	VAR_068006	P	314	S	PH4H_HUMAN	Disease (HPA)	199475650	A/B	P	314	S
124	UniProt	VAR_011574	I	318	T	PH4H_HUMAN	Disease (PKU)	62642918	A/B	I	318	T
125	UniProt	VAR_000998	A	322	G	PH4H_HUMAN	Disease (PKU)	62514958	A/B	A	322	G
126	UniProt	VAR_000999	A	322	T	PH4H_HUMAN	Disease (PKU)	62514957	A/B	A	322	T
127	UniProt	VAR_067759	A	322	V	PH4H_HUMAN	Disease (PKU)	---	A/B	A	322	V
128	UniProt	VAR_009245	Y	325	C	PH4H_HUMAN	Disease (PKU)	62508578	A/B	Y	325	C
129	UniProt	VAR_009246	E	330	D	PH4H_HUMAN	Disease (PKU)	62508580	A/B	E	330	D
130	UniProt	VAR_001000	F	331	L	PH4H_HUMAN	Disease (PKU)	62517179	A/B	F	331	L
131	UniProt	VAR_001001	L	333	F	PH4H_HUMAN	Disease (PKU)	62516060	A/B	L	333	F
132	UniProt	VAR_001002	C	334	S	PH4H_HUMAN	Disease (PKU)	62517174	A/B	C	334	S
133	UniProt	VAR_001003	G	337	V	PH4H_HUMAN	Disease (PKU)	62517206	A/B	G	337	V
134	UniProt	VAR_001004	D	338	Y	PH4H_HUMAN	Disease (PKU)	62516150	A/B	D	338	Y
135	UniProt	VAR_001005	K	341	R	PH4H_HUMAN	Disease (PKU)	62516153	A/B	K	341	R
136	UniProt	VAR_001006	K	341	T	PH4H_HUMAN	Disease (PKU)	62516153	A/B	K	341	T
137	UniProt	VAR_001007	A	342	T	PH4H_HUMAN	Disease (PKU)	62507282	A/B	A	342	T
138	UniProt	VAR_001008	Y	343	C	PH4H_HUMAN	Disease (PKU)	62507265	A/B	Y	343	C
139	UniProt	VAR_009247	G	344	R	PH4H_HUMAN	Disease (PKU)	62508679	A/B	G	344	R
140	UniProt	VAR_009248	G	344	V	PH4H_HUMAN	Disease (PKU)	62508582	A/B	G	344	V
141	UniProt	VAR_001009	A	345	S	PH4H_HUMAN	Disease (PKU)	62516062	A/B	A	345	S
142	UniProt	VAR_001010	A	345	T	PH4H_HUMAN	Disease (PKU)	62516062	A/B	A	345	T
143	UniProt	VAR_001011	L	347	F	PH4H_HUMAN	Disease (PKU)	62516154	A/B	L	347	F
144	UniProt	VAR_001012	L	348	V	PH4H_HUMAN	Disease (PKU)	62516092	A/B	L	348	V
145	UniProt	VAR_001013	S	349	L	PH4H_HUMAN	Disease (PKU)	62507279	A/B	S	349	L
146	UniProt	VAR_001014	S	349	P	PH4H_HUMAN	Disease (PKU)	62508646	A/B	S	349	P
147	UniProt	VAR_001015	S	350	T	PH4H_HUMAN	Disease (PKU)	62517183	A/B	S	350	T
148	UniProt	VAR_011575	C	357	G	PH4H_HUMAN	Disease (PKU)	62508595	A/B	C	357	G
149	UniProt	VAR_001016	P	362	T	PH4H_HUMAN	Disease (PKU)	62507329	A/B	P	362	T
150	UniProt	VAR_001019	P	366	H	PH4H_HUMAN	Disease (PKU)	62516098	A/B	P	366	H
151	UniProt	VAR_001020	T	372	S	PH4H_HUMAN	Disease (PKU)	62517163	A/B	T	372	S
152	UniProt	VAR_001021	Y	377	C	PH4H_HUMAN	Disease (PKU)	62642942	A/B	Y	377	C
153	UniProt	VAR_001022	T	380	M	PH4H_HUMAN	Disease (Non-PKU HPA)	62642937	A/B	T	380	M
154	UniProt	VAR_001023	Y	386	C	PH4H_HUMAN	Disease (PKU)	62516141	A/B	Y	386	C
155	UniProt	VAR_001024	Y	387	H	PH4H_HUMAN	Disease (PKU)	62517194	A/B	Y	387	H
156	UniProt	VAR_001025	V	388	L	PH4H_HUMAN	Disease (PKU)	62516101	A/B	V	388	L
157	UniProt	VAR_001026	V	388	M	PH4H_HUMAN	Disease (PKU)	62516101	A/B	V	388	M
158	UniProt	VAR_001027	E	390	G	PH4H_HUMAN	Disease (PKU)	5030856	A/B	E	390	G
159	UniProt	VAR_001028	D	394	A	PH4H_HUMAN	Disease (PKU)	62516102	A/B	D	394	A
160	UniProt	VAR_001029	D	394	H	PH4H_HUMAN	Disease (PKU)	62516142	A/B	D	394	H
161	UniProt	VAR_001030	A	395	G	PH4H_HUMAN	Disease (PKU)	62508736	A/B	A	395	G
162	UniProt	VAR_001031	A	395	P	PH4H_HUMAN	Disease (PKU)	62516103	A/B	A	395	P
163	UniProt	VAR_001033	A	403	V	PH4H_HUMAN	Disease (PKU)	5030857	A/B	A	403	V
164	UniProt	VAR_068007	P	407	L	PH4H_HUMAN	Disease (PKU)	62644473	A/B	P	407	L
165	UniProt	VAR_011576	P	407	S	PH4H_HUMAN	Disease (PKU)	62644465	A/B	P	407	S
166	UniProt	VAR_001034	R	408	Q	PH4H_HUMAN	Disease (PKU)	5030859	A/B	R	408	Q
167	UniProt	VAR_001035	R	408	W	PH4H_HUMAN	Disease (PKU)	5030858	A/B	R	408	W
168	UniProt	VAR_009249	F	410	S	PH4H_HUMAN	Disease (PKU)	62644475	A/B	F	410	S
169	UniProt	VAR_001036	R	413	P	PH4H_HUMAN	Disease (PKU)	79931499	A/B	R	413	P
170	UniProt	VAR_001037	R	413	S	PH4H_HUMAN	Disease (PKU)	62644467	A/B	R	413	S
171	UniProt	VAR_001038	Y	414	C	PH4H_HUMAN	Disease (PKU)	5030860	A/B	Y	414	C
172	UniProt	VAR_001039	D	415	N	PH4H_HUMAN	Disease (PKU)	62644499	A/B	D	415	N
173	UniProt	VAR_068008	Y	417	H	PH4H_HUMAN	Disease (PKU)	62644471	A/B	Y	417	H
174	UniProt	VAR_001040	T	418	P	PH4H_HUMAN	Disease (PKU)	62644501	A/B	T	418	P
175	UniProt	VAR_067760	I	421	S	PH4H_HUMAN	Disease (PKU)	---	A/B	I	421	S
176	UniProt	VAR_001041	L	430	P	PH4H_HUMAN	Disease (PKU)	199475607	A/B	L	430	P
177	UniProt	VAR_001042	A	447	D	PH4H_HUMAN	Disease (PKU)	76542238	A/B	A	447	D

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Asymmetric Unit

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:329
 aligned with PH4H_HUMAN | P00439 from UniProtKB/Swiss-Prot  Length:452

    Alignment length:335
                                   127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447     
           PH4H_HUMAN   118 VPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVLDNTQQLKILADSINSEIGILCSALQKIK 452
               SCOP domains d2paha_ A: Phenylal      anine hydroxylase, PAH                                                                                                                                                                                                                                                                                                 SCOP domains
               CATH domains 2pahA00 A:118-452 P      henylalanine Hydroxylase                                                                                                                                                                                                                                                                                               CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .......hhhhh.......------....hhhh...hhhhhhhhhhhhhh.............hhhhhhhhhhhhhhh........hhhhhhhhhhhhh..........hhhhhhhhhhh...eeee........hhhhhhhh.eeee......hhh..........hhhhh.hhhhh.hhhhhhhhhhhhhh....hhhhhhhhhhhhhh....eeee..eeee....hhh.hhhhhhhh.................................hhhhhhhhhhhhh......eeeee....eeeee.hhhhhhhhhhhhhhhhhhhhhhhhh.. Sec.struct. author
             SAPs(SNPs) (1) ---L--I----Y-------------G-VY-S--H--NP-NQ-PS--T--I-HDA-TTALLG----Q------A---P-Y----R--CADD---TPP---GV--GV-MRH---IF-L----PSSCFQLADVPF--G--S-C-T-P-LLG---LKY-FELICA-KLNF------Y------C-CS--PR-V--DFP--H---T---G--C----DL-FS--VY--RTCRS-FVLT------G----T---H-----S----C--M-----CHL-G---AG-------V---LQ-S--PCN-HP--S--------P----------------D----- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------------SW--------S--QR--V-PM-----------------------Y-----S-----------------T-----P---------H---E------Q--V---V-Q--------S-----VDN----N-------------H--V--------VY---S-------T------------------T--VT---P--------------------------------------M-----HP-----------SW----S--------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ----------------------------------------------------R----------------------------------------------------------------------L---L------W---------------------------------------------------------------------V---------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (3)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------BH4_AAA_HYDR---------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2pah A 118 VPWFPRTIQELDRFANQIL------DADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVLDNTQQLKILADSINSEIGILCSALQKIK 452
                                   127        |-     | 147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447     
                                            136    143

Chain B from PDB  Type:PROTEIN  Length:322
 aligned with PH4H_HUMAN | P00439 from UniProtKB/Swiss-Prot  Length:452

    Alignment length:335
                                   127       137       147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447     
           PH4H_HUMAN   118 VPWFPRTIQELDRFANQILSYGAELDADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVLDNTQQLKILADSINSEIGILCSALQKIK 452
               SCOP domains d2pahb_ B: Ph             enylalanine hydroxylase, PAH                                                                                                                                                                                                                                                                                          SCOP domains
               CATH domains 2pahB00 B:118             -452 Phenylalanine Hydroxylase                                                                                                                                                                                                                                                                                        CATH domains
           Pfam domains (1) -Biopterin_H-             2pahB01 B:119-450                                                                                                                                                                                                                                                                                                  -- Pfam domains (1)
           Pfam domains (2) -Biopterin_H-             2pahB02 B:119-450                                                                                                                                                                                                                                                                                                  -- Pfam domains (2)
         Sec.struct. author ........hhh..-------------...hhhh...hhhhhhhhhhhhhh.............hhhhhhhhhhhhhhh........hhhhhhhhhhhhh..........hhhhhhhhhhh...eeee........hhhhhhhh.eeee......hhh..........hhhhh.hhhhh.hhhhhhhhhhhhhh....hhhhhhhhhhhhhh....eeee..eeee....hhh.hhhh.....................................hhhhhhhhhhhhhh.....eeeee....eeeee.....hhhhhhhhhhhhhhhhhhhh... Sec.struct. author
             SAPs(SNPs) (1) ---L--I----Y---------------VY-S--H--NP-NQ-PS--T--I-HDA-TTALLG----Q------A---P-Y----R--CADD---TPP---GV--GV-MRH---IF-L----PSSCFQLADVPF--G--S-C-T-P-LLG---LKY-FELICA-KLNF------Y------C-CS--PR-V--DFP--H---T---G--C----DL-FS--VY--RTCRS-FVLT------G----T---H-----S----C--M-----CHL-G---AG-------V---LQ-S--PCN-HP--S--------P----------------D----- SAPs(SNPs) (1)
             SAPs(SNPs) (2) ---------------------------------------SW--------S--QR--V-PM-----------------------Y-----S-----------------T-----P---------H---E------Q--V---V-Q--------S-----VDN----N-------------H--V--------VY---S-------T------------------T--VT---P--------------------------------------M-----HP-----------SW----S--------------------------------------- SAPs(SNPs) (2)
             SAPs(SNPs) (3) ----------------------------------------------------R----------------------------------------------------------------------L---L------W---------------------------------------------------------------------V---------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) (3)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------------------------BH4_AAA_HYDR---------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2pah B 118 VPWFPRTIQELDR-------------ADHPGFKDPVYRARRKQFADIAYNYRHGQPIPRVEYMEEEKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVLDNTQQLKILADSINSEIGILCSALQKIK 452
                                   127  |      -      |147       157       167       177       187       197       207       217       227       237       247       257       267       277       287       297       307       317       327       337       347       357       367       377       387       397       407       417       427       437       447     
                                      130           144

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (1, 2)

Gene Ontology (24, 24)

Asymmetric Unit(hide GO term definitions)

Chain A,B (PH4H_HUMAN | P00439)

molecular function
	GO:0016597	amino acid binding	Interacting selectively and non-covalently with an amino acid, organic acids containing one or more amino substituents.
	GO:0003824	catalytic activity	Catalysis of a biochemical reaction at physiological temperatures. In biologically catalyzed reactions, the reactants are known as substrates, and the catalysts are naturally occurring macromolecular substances known as enzymes. Enzymes possess specific binding sites for substrates, and are usually composed wholly or largely of protein, but RNA that has catalytic activity (ribozyme) is often also regarded as enzymatic.
	GO:0048037	cofactor binding	Interacting selectively and non-covalently with a cofactor, a substance that is required for the activity of an enzyme or other protein. Cofactors may be inorganic, such as the metal atoms zinc, iron, and copper in certain forms, or organic, in which case they are referred to as coenzymes. Cofactors may either be bound tightly to active sites or bind loosely with the substrate.
	GO:0005506	iron ion binding	Interacting selectively and non-covalently with iron (Fe) ions.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0004497	monooxygenase activity	Catalysis of the incorporation of one atom from molecular oxygen into a compound and the reduction of the other atom of oxygen to water.
	GO:0016491	oxidoreductase activity	Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
	GO:0016714	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen	Catalysis of an oxidation-reduction (redox) reaction in which hydrogen or electrons are transferred from reduced pteridine and one other donor, and one atom of oxygen is incorporated into one donor.
	GO:0004505	phenylalanine 4-monooxygenase activity	Catalysis of the reaction: L-phenylalanine + tetrahydrobiopterin + O2 = L-tyrosine + 4-alpha-hydroxytetrahydrobiopterin.
	GO:0042803	protein homodimerization activity	Interacting selectively and non-covalently with an identical protein to form a homodimer.
biological process
	GO:0006559	L-phenylalanine catabolic process	The chemical reactions and pathways resulting in the breakdown of phenylalanine, 2-amino-3-phenylpropanoic acid.
	GO:0006558	L-phenylalanine metabolic process	The chemical reactions and pathways involving L-phenylalanine, the L-enantiomer of 2-amino-3-phenylpropanoic acid, i.e. (2S)-2-amino-3-phenylpropanoic acid.
	GO:0009072	aromatic amino acid family metabolic process	The chemical reactions and pathways involving aromatic amino acid family, amino acids with aromatic ring (phenylalanine, tyrosine, tryptophan).
	GO:0042423	catecholamine biosynthetic process	The chemical reactions and pathways resulting in the formation of any of a group of physiologically important biogenic amines that possess a catechol (3,4-dihydroxyphenyl) nucleus and are derivatives of 3,4-dihydroxyphenylethylamine.
	GO:0008652	cellular amino acid biosynthetic process	The chemical reactions and pathways resulting in the formation of amino acids, organic acids containing one or more amino substituents.
	GO:0008152	metabolic process	The chemical reactions and pathways, including anabolism and catabolism, by which living organisms transform chemical substances. Metabolic processes typically transform small molecules, but also include macromolecular processes such as DNA repair and replication, and protein synthesis and degradation.
	GO:0042136	neurotransmitter biosynthetic process	The chemical reactions and pathways resulting in the formation of any of a group of substances that are released on excitation from the axon terminal of a presynaptic neuron of the central or peripheral nervous system and travel across the synaptic cleft to either excite or inhibit the target cell.
	GO:0055114	oxidation-reduction process	A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
	GO:0018126	protein hydroxylation	The addition of a hydroxy group to a protein amino acid.
	GO:0042558	pteridine-containing compound metabolic process	The chemical reactions and pathways involving any compound containing pteridine (pyrazino(2,3-dipyrimidine)), e.g. pteroic acid, xanthopterin and folic acid.
	GO:0046146	tetrahydrobiopterin metabolic process	The chemical reactions and pathways involving tetrahydrobiopterin, the reduced form of biopterin (2-amino-4-hydroxy-6-(1,2-dihydroxypropyl)-pteridine). It functions as a hydroxylation coenzyme, e.g. in the conversion of phenylalanine to tyrosine.
	GO:0006571	tyrosine biosynthetic process	The chemical reactions and pathways resulting in the formation of tyrosine, an aromatic amino acid, 2-amino-3-(4-hydroxyphenyl)propanoic acid.
cellular component
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0070062	extracellular exosome	A vesicle that is released into the extracellular region by fusion of the limiting endosomal membrane of a multivesicular body with the plasma membrane. Extracellular exosomes, also simply called exosomes, have a diameter of about 40-100 nm.

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (1, 2)

Sites (4, 4)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (177, 353)

PROSITE Motifs (1, 2)

Exons (0, 0)

Sequences/Alignments

Classification and Annotation

SCOP Domains (1, 2)

CATH Domains (1, 2)

Pfam Domains (1, 2)

Gene Ontology (24, 24)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File