|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 4)| Asymmetric Unit (2, 4) Biological Unit 1 (1, 9) Biological Unit 2 (1, 72) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2P6Y) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2P6Y) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2P6Y) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2P6Y) |
Exons (0, 0)| (no "Exon" information available for 2P6Y) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:131 aligned with Q9KM02_VIBCH | Q9KM02 from UniProtKB/TrEMBL Length:130 Alignment length:132 130 10 20 30 40 50 60 70 80 90 100 110 120 130 Q9KM02_VIBCH 1 MIHLIALRLTRGMDLKQQIVQLVQQHRIHAGSIASCVGCLSTLHIRLADSVSTLQVSAPFEILSLSGTLTYQHCHLHIAVADAQGRVWGGHLLEGNLINTTAELMIHHYPQHHFTREFDPNTGYSELVVS-- - SCOP domains d2p6ya_ A: automated matches SCOP domains CATH domains -2p6yA00 A:2-132 Hypothetical protein, similar to alpha- acetolactate decarboxylase; domain 2 CATH domains Pfam domains -DUF296-2p6yA01 A:2-116 ---------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------ Transcript 2p6y A 1 mIHLIALRLTRGmDLKQQIVQLVQQHRIHAGSIASCVGCLSTLHIRLADSVSTLQVSAPFEILSLSGTLTYQHCHLHIAVADAQGRVWGGHLLEGNLIN-TAELmIHHYPQHHFTREFDPNTGYSELVVSAA 132 | 10 | 20 30 40 50 60 70 80 90 |-| | 110 120 130 | 13-MSE 99 | | 1-MSE 101 | 105-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)
Asymmetric Unit
|
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (1, 1)
Asymmetric Unit
|
Gene Ontology (4, 4)|
Asymmetric Unit(hide GO term definitions) Chain A (Q9KM02_VIBCH | Q9KM02)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|