|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 13)
Asymmetric/Biological Unit (1, 13)
|
Sites (0, 0)| (no "Site" information available for 2P1A) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2P1A) |
Cis Peptide Bonds (1, 1)
Asymmetric/Biological Unit
|
||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2P1A) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2P1A) |
Exons (0, 0)| (no "Exon" information available for 2P1A) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:143 aligned with Q739H9_BACC1 | Q739H9 from UniProtKB/TrEMBL Length:153 Alignment length:143 1 | 9 19 29 39 49 59 69 79 89 99 109 119 129 139 Q739H9_BACC1 - -MFVQSALHQLKVAVDTSIQMLDQYTEIDLKIAPIQSKRSLFEMYAHLSLICHADLLILNGSTEKELHTFYKEQTPETIAQMQKTMIQGYDLLSKTFLSYSNEQLAEMKTAYWGISYSRFEWLLEIVAHFYHHRGQIHILLCE 142 SCOP domains -d2p1aa1 A:1-142 Hypothetical protein BCE2162 SCOP domains CATH domains 2p1aA00 A:0-142 dinb family like domain CATH domains Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2p1a A 0 GmFVQSALHQLKVAVDTSIQmLDQYTEIDLKIAPIQSKRSLFEmYAHLSLICHADLLILNGSTEKELHTFYKEQTPETIAQmQKTmIQGYDLLSKTFLSYSNEQLAEmKTAYWGISYSRFEWLLEIVAHFYHHRGQIHILLCE 142 | 9 19| 29 39 | 49 59 69 79 | | 89 99 109 119 129 139 | 20-MSE 43-MSE 81-MSE 107-MSE 1-MSE 85-MSE Chain B from PDB Type:PROTEIN Length:150 aligned with Q739H9_BACC1 | Q739H9 from UniProtKB/TrEMBL Length:153 Alignment length:150 1 | 9 19 29 39 49 59 69 79 89 99 109 119 129 139 149 Q739H9_BACC1 - -MFVQSALHQLKVAVDTSIQMLDQYTEIDLKIAPIQSKRSLFEMYAHLSLICHADLLILNGSTEKELHTFYKEQTPETIAQMQKTMIQGYDLLSKTFLSYSNEQLAEMKTAYWGISYSRFEWLLEIVAHFYHHRGQIHILLCEHMKDPNI 149 SCOP domains d2p1ab_ B: Hypothetical protein BCE2162 SCOP domains CATH domains 2p1aB01 B:0-145 dinb family like domain ---- CATH domains Pfam domains (1) ---------DinB_2-2p1aB01 B:9-136 ------------- Pfam domains (1) Pfam domains (2) ---------DinB_2-2p1aB02 B:9-136 ------------- Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript 2p1a B 0 GmFVQSALHQLKVAVDTSIQmLDQYTEIDLKIAPIQSKRSLFEmYAHLSLICHADLLILNGSTEKELHTFYKEQTPETIAQmQKTmIQGYDLLSKTFLSYSNEQLAEmKTAYWGISYSRFEWLLEIVAHFYHHRGQIHILLCEHmKDPNI 149 | 9 19| 29 39 | 49 59 69 79 | | 89 99 109 119 129 139 | 149 1-MSE 20-MSE 43-MSE 81-MSE 107-MSE 144-MSE 85-MSE
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric/Biological Unit
|
CATH Domains (1, 2)
Asymmetric/Biological Unit
|
Pfam Domains (1, 2)
Asymmetric/Biological Unit
|
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2P1A)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|