|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (2, 3) |
Asymmetric Unit (1, 1)
|
(no "SS Bond" information available for 2P13) |
(no "Cis Peptide Bond" information available for 2P13) |
(no "SAP(SNP)/Variant" information available for 2P13) |
(no "PROSITE Motif" information available for 2P13) |
(no "Exon" information available for 2P13) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:85 aligned with Q82SS8_NITEU | Q82SS8 from UniProtKB/TrEMBL Length:520 Alignment length:85 440 450 460 470 480 490 500 510 Q82SS8_NITEU 431 EKVVAEQQADGTWLMDGWISIRKASNLLEHDLVDEAERYSTLGGYLLWQFGYIPAAGEQITVDGLIFEIVSVNKHNIGKVRVHRT 515 SCOP domains d2p13a1 A:431-515 Uncharacterized protein NE2227 SCOP domains CATH domains 2p13A00 A:431-515 [code=3.30.465.10, no name defined] CATH domains Pfam domains ------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------- Transcript 2p13 A 431 EKVVAEQQADGTWLmDGWISIRKASNLLEHDLVDEAERYSTLGGYLLWQFGYIPAAGEQITVDGLIFEIVSVNKHNIGKVRVHRT 515 440 | 450 460 470 480 490 500 510 445-MSE Chain B from PDB Type:PROTEIN Length:83 aligned with Q82SS8_NITEU | Q82SS8 from UniProtKB/TrEMBL Length:520 Alignment length:85 440 450 460 470 480 490 500 510 Q82SS8_NITEU 431 EKVVAEQQADGTWLMDGWISIRKASNLLEHDLVDEAERYSTLGGYLLWQFGYIPAAGEQITVDGLIFEIVSVNKHNIGKVRVHRT 515 SCOP domains d2p13b_ B: Uncharacterized protei n NE2227 SCOP domains CATH domains 2p13B00 B:431-515 [code=3.30.465 .10, no name defined] CATH domains Pfam domains (1) -----CorC_HlyC-2p13B01 B:436-515 Pfam domains (1) Pfam domains (2) -----CorC_HlyC-2p13B02 B:436-515 Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------- Transcript 2p13 B 431 EKVVAEQQADGTWLmDGWISIRKASNLLEHDLV--AERYSTLGGYLLWQFGYIPAAGEQITVDGLIFEIVSVNKHNIGKVRVHRT 515 440 | 450 460 | | 470 480 490 500 510 445-MSE 463 | 466
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (Q82SS8_NITEU | Q82SS8)
|
|
|
|
|
|
|