|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 5)| Asymmetric/Biological Unit (2, 5) |
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2OY9) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2OY9) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2OY9) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2OY9) |
Exons (0, 0)| (no "Exon" information available for 2OY9) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:85 aligned with Y2638_BACHD | Q9K9K7 from UniProtKB/Swiss-Prot Length:88 Alignment length:85 13 23 33 43 53 63 73 83 Y2638_BACHD 4 TLPISLDWSTEEVIDVVHFFQAIEQAYDQGIAREDLLGKYRRFKEIVPSKSEEKQLFRAYEQENDVSCYQTIKKAREEMEEHIQM 88 SCOP domains d2oy9a1 A:6-90 Uncharacterized protein BH2638 SCOP domains CATH domains --------2oy9A01 A:14-89 BH2638-like domains - CATH domains Pfam domains ------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------- Transcript 2oy9 A 6 TLPISLDWSTEEVIDVVHFFQAIEQAYDQGIAREDLLGKYRRFKEIVPSKSEEKQLFRAYEQENDVSCYQTIKKAREEmEEHIQm 90 15 25 35 45 55 65 75 85 | 84-MSE | 90-MSE Chain B from PDB Type:PROTEIN Length:82 aligned with Y2638_BACHD | Q9K9K7 from UniProtKB/Swiss-Prot Length:88 Alignment length:82 16 26 36 46 56 66 76 86 Y2638_BACHD 7 ISLDWSTEEVIDVVHFFQAIEQAYDQGIAREDLLGKYRRFKEIVPSKSEEKQLFRAYEQENDVSCYQTIKKAREEMEEHIQM 88 SCOP domains d2oy9b_ B: Uncharacterized protein BH2638 SCOP domains CATH domains -----2oy9B01 B:14-89 BH2638-like domains - CATH domains Pfam domains (1) UPF0223-2oy9B01 B:9-90 Pfam domains (1) Pfam domains (2) UPF0223-2oy9B02 B:9-90 Pfam domains (2) SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------- Transcript 2oy9 B 9 ISLDWSTEEVIDVVHFFQAIEQAYDQGIAREDLLGKYRRFKEIVPSKSEEKQLFRAYEQENDVSCYQTIKKAREEmEEHIQm 90 18 28 38 48 58 68 78 | 88 | 84-MSE | 90-MSE
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric/Biological Unit
|
CATH Domains (1, 2)
Asymmetric/Biological Unit
|
Pfam Domains (1, 2)
Asymmetric/Biological Unit
|
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2OY9)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|