|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2OUT) |
Sites (0, 0)| (no "Site" information available for 2OUT) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2OUT) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2OUT) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2OUT) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2OUT) |
Exons (0, 0)| (no "Exon" information available for 2OUT) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:131 aligned with VG35_HAEIN | P44228 from UniProtKB/Swiss-Prot Length:128 Alignment length:131 1 | 7 17 27 37 47 57 67 77 87 97 107 117 127 VG35_HAEIN - ---MDKTFCVVVQNRIKEGYRRAGFSFHLGDNSLAAVSESQLAQLKADPRLVVQITETGSQEGGEGLSKEPAGSDEQKQLRADPPSTDLNTFTVEQLKAQLTERGITFKQSATKAELIALFAPADGEKSEA 128 SCOP domains ---d2outa2 A:4-70 Mu-like prophage FluMu protein gp35, HI1506 -----------------------d2outa1 A:94-131 SCOP domains CATH domains ----------------------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------------------HeH-2outA01 A:89-122 --------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------------------------------------------------------- Transcript 2out A 1 GSHMDKTFCVVVQNRIKEGYRRAGFSFHLGDNSLAAVSESQLAQLKADPRLVVQITETGSQEGGEGLSKEPAGSDEQKQLRADPPSTDLNTFTVEQLKAQLTERGITFKQSATKAELIALFAPADGEKSEA 131 10 20 30 40 50 60 70 80 90 100 110 120 130
|
||||||||||||||||||||
SCOP Domains (2, 2)| NMR Structure |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2OUT) |
Pfam Domains (1, 1)
NMR Structure
|
Gene Ontology (1, 1)|
NMR Structure(hide GO term definitions) Chain A (VG35_HAEIN | P44228)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|