|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (4, 8)| Asymmetric Unit (4, 8) Biological Unit 1 (3, 14) |
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2OU6) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2OU6) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2OU6) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2OU6) |
Exons (0, 0)| (no "Exon" information available for 2OU6) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:183 aligned with Q9RVG4_DEIRA | Q9RVG4 from UniProtKB/TrEMBL Length:189 Alignment length:183 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 Q9RVG4_DEIRA 2 PTFNPELHAQTLNSERAYFVQPDADPAFTPHIGALVEMLTYARLTTLQAVEGLPEDQLWATAPGFANSIGTLLAHIAAVERVYHVLSFQGRDVTPEDDGAAYWGLTMGKEGTAPARLPTLDELRAELADARAETLRVFAAKDDAWLAEPLGPGWANQHWAWFHVMEDEVNHRGQLRLLRQVLA 184 SCOP domains d2ou6a1 A:2-184 Hypothetical protein DR1065 SCOP domains CATH domains 2ou6A00 A:2-184 dinb family like domain CATH domains Pfam domains ---------------------------------DUF664-2ou6A01 A:35-184 Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript 2ou6 A 2 PTFNPELHAQTLNSERAYFVQPDADPAFTPHIGALVEmLTYARLTTLQAVEGLPEDQLWATAPGFANSIGTLLAHIAAVERVYHVLSFQGRDVTPEDDGAAYWGLTmGKEGTAPARLPTLDELRAELADARAETLRVFAAKDDAWLAEPLGPGWANQHWAWFHVmEDEVNHRGQLRLLRQVLA 184 11 21 31 |41 51 61 71 81 91 101 |111 121 131 141 151 161 | 171 181 39-MSE 108-MSE 166-MSE
|
||||||||||||||||||||
SCOP Domains (1, 1)| Asymmetric Unit |
CATH Domains (1, 1)
Asymmetric Unit
|
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (0, 0)|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2OU6)
|
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|