|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 2)| Asymmetric/Biological Unit (2, 2) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2OPC) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2OPC) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2OPC) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2OPC) |
Exons (0, 0)| (no "Exon" information available for 2OPC) |
Sequences/Alignments
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:115 aligned with Q6R661_MELLI | Q6R661 from UniProtKB/TrEMBL Length:150 Alignment length:115 45 55 65 75 85 95 105 115 125 135 145 Q6R661_MELLI 36 EGYTRFYRSPTASVILSGLVKVKWDNEQMTMPLFKWIGGEQAEELHFCVHIAHSSGPKLNRARSLGTVNSNMDQHWAQAQRNSGATRRTIEGFHLFENDIPNFPDYIKIKLVPKT 150 SCOP domains ------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains AvrL567-A-2opcA01 A:36-150 Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------- Transcript 2opc A 36 EGYTRFYRSPTASVILSGLVKVKWDNEQMTMPLFKWIGGEQAEELHFCVHIAHSSGPKLNRARSLGTVNSNMDQHWAQAQRNSGATRRTIEGFHLFENDIPNFPDYIKIKLVPKT 150 45 55 65 75 85 95 105 115 125 135 145
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2OPC) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2OPC) |
Pfam Domains (1, 1)
Asymmetric/Biological Unit
|
Gene Ontology (0, 0)|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2OPC)
|
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|