![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
(no "Ligand,Modified Residues,Ions" information available for 2OP8) |
(no "Site" information available for 2OP8) |
(no "SS Bond" information available for 2OP8) |
(no "Cis Peptide Bond" information available for 2OP8) |
(no "SAP(SNP)/Variant" information available for 2OP8) |
(no "PROSITE Motif" information available for 2OP8) |
(no "Exon" information available for 2OP8) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:61 aligned with 4OT_BACSU | P70994 from UniProtKB/Swiss-Prot Length:62 Alignment length:61 11 21 31 41 51 61 4OT_BACSU 2 PYVTVKMLEGRTDEQKRNLVEKVTEAVKETTGASEEKIVVFIEEMRKDHYAVAGKRLSDME 62 SCOP domains d2op8a_ A: automated matches SCOP domains CATH domains ------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------- Transcript 2op8 A 1 PYVTVKMLEGRTDEQKRNLVEKVTEAVKETTGASEEKIVVFIEEMRKDHYAVAGKRLSDME 61 10 20 30 40 50 60 Chain B from PDB Type:PROTEIN Length:61 aligned with 4OT_BACSU | P70994 from UniProtKB/Swiss-Prot Length:62 Alignment length:61 11 21 31 41 51 61 4OT_BACSU 2 PYVTVKMLEGRTDEQKRNLVEKVTEAVKETTGASEEKIVVFIEEMRKDHYAVAGKRLSDME 62 SCOP domains d2op8b_ B: automated matches SCOP domains CATH domains ------------------------------------------------------------- CATH domains Pfam domains ------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------- Transcript 2op8 B 1 PYVTVKMLEGRTDEQKRNLVEKVTEAVKETTGASEEKIVVFIEEMRKDHYAVAGKRLSDME 61 10 20 30 40 50 60
|
Asymmetric Unit
|
(no "CATH Domain" information available for 2OP8) |
(no "Pfam Domain" information available for 2OP8) |
Asymmetric Unit(hide GO term definitions) Chain A,B (4OT_BACSU | P70994)
|
|
|
|
|
|
|