|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (3, 7)
Asymmetric Unit (3, 7)
|
Sites (5, 5)
Asymmetric Unit (5, 5)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2OOC) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2OOC) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2OOC) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2OOC) |
Exons (0, 0)| (no "Exon" information available for 2OOC) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:104 aligned with Q9A980_CAUCR | Q9A980 from UniProtKB/TrEMBL Length:112 Alignment length:104 17 27 37 47 57 67 77 87 97 107 Q9A980_CAUCR 8 GAVDFAYLEGFAAGDFAVVDEVLALFREQAALWAPMLDPTHPGWKDAVHTVKGAARGVGAFNLGEVCERCEAGQESLEGVRTALDAALLDIAAYAHEQALRSLK 111 SCOP domains d2ooca1 A:8-111 Histidine phosphotransferase ShpA SCOP domains CATH domains 2oocA00 A:8-111 [code=1.20.120.160, no name defined] CATH domains Pfam domains -------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------------------------------- Transcript 2ooc A 8 GAVDFAYLEGFAAGDFAVVDEVLALFREQAALWAPmLDPTHPGWKDAVHTVKGAARGVGAFNLGEVCERCEAGQESLEGVRTALDAALLDIAAYAHEQALRSLK 111 17 27 37 | 47 57 67 77 87 97 107 43-MSE Chain B from PDB Type:PROTEIN Length:105 aligned with Q9A980_CAUCR | Q9A980 from UniProtKB/TrEMBL Length:112 Alignment length:105 17 27 37 47 57 67 77 87 97 107 Q9A980_CAUCR 8 GAVDFAYLEGFAAGDFAVVDEVLALFREQAALWAPMLDPTHPGWKDAVHTVKGAARGVGAFNLGEVCERCEAGQESLEGVRTALDAALLDIAAYAHEQALRSLKG 112 SCOP domains d2oocb_ B: Histidine phosphotransferase ShpA SCOP domains CATH domains 2oocB00 B:8-112 [code=1.20.120.160, no name defined] CATH domains Pfam domains --------------------------------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------------------------------- Transcript 2ooc B 8 GAVDFAYLEGFAAGDFAVVDEVLALFREQAALWAPmLDPTHPGWKDAVHTVKGAARGVGAFNLGEVCERCEAGQESLEGVRTALDAALLDIAAYAHEQALRSLKG 112 17 27 37 | 47 57 67 77 87 97 107 43-MSE
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (1, 2)
Asymmetric Unit
|
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2OOC) |
Gene Ontology (4, 4)|
Asymmetric Unit(hide GO term definitions) Chain A,B (Q9A980_CAUCR | Q9A980)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|