Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF INDOL-3-ACETALDEHYDE DERIVED TTQ-AMIDE ADDUCT OF AROMATIC AMINE DEHYDROGENASE
 
Authors :  A. Roujeinikova, D. Leys
Date :  15 Jan 07  (Deposition) - 01 May 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.60
Chains :  Asym./Biol. Unit :  A,B,D,H
Keywords :  Oxidoreductase, Ttq (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  A. Roujeinikova, P. Hothi, L. Masgrau, M. J. Sutcliffe, N. S. Scrutton D. Leys
New Insights Into The Reductive Half-Reaction Mechanism Of Aromatic Amine Dehydrogenase Revealed By Reaction With Carbinolamine Substrates.
J. Biol. Chem. V. 282 23766 2007
PubMed-ID: 17475620  |  Reference-DOI: 10.1074/JBC.M700677200

(-) Compounds

Molecule 1 - AROMATIC AMINE DEHYDROGENASE, SMALL SUBUNIT
    Chains: D, H
    EC Number: 1.4.99.4
    Fragment: (RESIDUES 48-182)
    Organism Scientific: ALCALIGENES FAECALIS
    Organism Taxid: 511
 
Molecule 2 - AROMATIC AMINE DEHYDROGENASE, LARGE SUBUNIT
    Chains: A, B
    EC Number: 1.4.99.4
    Fragment: (RESIDUES 73-433)
    Organism Scientific: ALCALIGENES FAECALIS
    Organism Taxid: 511

 Structural Features

(-) Chains, Units

  1234
Asymmetric/Biological Unit : ABDH

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 4)

Asymmetric/Biological Unit (2, 4)
No.NameCountTypeFull Name
1TRQ2Mod. Amino Acid2-AMINO-3-(6,7-DIOXO-6,7-DIHYDRO-1H-INDOL-3-YL)-PROPIONIC ACID
2TSR2Ligand/Ion2-(1H-INDOL-3-YL)ACETAMIDE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREPHE B:97 , LEU B:100 , GLY B:178 , ASP D:84 , TRQ D:109 , ASP D:128 , ASN D:156 , VAL D:158 , ASN D:159 , TRP D:160 , PHE D:169 , THR D:172BINDING SITE FOR RESIDUE TSR D 292
2AC2SOFTWARELEU A:100 , ASP H:84 , TRQ H:109 , ASP H:128 , ASN H:156 , VAL H:158 , ASN H:159 , TRP H:160 , PHE H:169 , THR H:172BINDING SITE FOR RESIDUE TSR H 291

(-) SS Bonds  (16, 16)

Asymmetric/Biological Unit
No.Residues
1A:225 -A:242
2B:225 -B:242
3D:75 -D:140
4D:81 -D:113
5D:88 -D:171
6D:90 -D:138
7D:91 -D:135
8D:98 -D:129
9D:130 -D:161
10H:75 -H:140
11H:81 -H:113
12H:88 -H:171
13H:90 -H:138
14H:91 -H:135
15H:98 -H:129
16H:130 -H:161

(-) Cis Peptide Bonds  (4, 4)

Asymmetric/Biological Unit
No.Residues
1Ser A:200 -Pro A:201
2Gly A:309 -Pro A:310
3Ser B:200 -Pro B:201
4Gly B:309 -Pro B:310

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2OJY)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2OJY)

(-) Exons   (0, 0)

(no "Exon" information available for 2OJY)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:360
 aligned with AAUB_ALCFA | P84888 from UniProtKB/Swiss-Prot  Length:390

    Alignment length:360
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389
           AAUB_ALCFA    30 REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG 389
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ............hhh.eeeeee.hhhhhhh.eeeeee.....eeeeee..eeeeeee.....eeeeeeeee.......eeeeeeeee.....eeeeeee.........hhh.eee.....eeeeeee...eeeeeee....eeeeeehhhh.eeeeee......eeeeee....eeeeee.....eeeeee................ee...eeeee....eeeeee......eeeeeee..hhhhhhh..ee.....eee.....eeeeeee.............eeeeee....eeeeeee.....eeeee....eeeee....eeeee......eeeeee........eeee..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 2ojy A  73 REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG 432
                                    82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432


Chain B from PDB  Type:PROTEIN  Length:361
 aligned with AAUB_ALCFA | P84888 from UniProtKB/Swiss-Prot  Length:390

    Alignment length:361
                                    39        49        59        69        79        89        99       109       119       129       139       149       159       169       179       189       199       209       219       229       239       249       259       269       279       289       299       309       319       329       339       349       359       369       379       389 
           AAUB_ALCFA    30 REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGGV 390
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
           Pfam domains (1) -------------Me-amine-dh_H-2ojyB01 B:86-424                                                                                                                                                                                                                                                                                                                     --------- Pfam domains (1)
           Pfam domains (2) -------------Me-amine-dh_H-2ojyB02 B:86-424                                                                                                                                                                                                                                                                                                                     --------- Pfam domains (2)
         Sec.struct. author ............hhh.eeeeee.hhhhhhh.eeeeee.....eeeeee..eeeeeee.....eeeeeeeee.......eeeeeeeee.....eeeeeee.........hhh.eee.....eeeeeee...eeeeeee....eeeeeehhhh.eeeeee......eeeeee....eeeeee.....eeeeee................ee...eeeee....eeeeee......eeeeeee..hhhhhhh..ee.....eeee....eeeeeee.............eeeeee....eeeeeee.....eeeee....eeeee....eeeee......eeeeee........eeee...... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2ojy B  73 REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGGT 433
                                    82        92       102       112       122       132       142       152       162       172       182       192       202       212       222       232       242       252       262       272       282       292       302       312       322       332       342       352       362       372       382       392       402       412       422       432 


Chain D from PDB  Type:PROTEIN  Length:110
 aligned with AAUA_ALCFA | P84887 from UniProtKB/Swiss-Prot  Length:182

    Alignment length:110
                                    80        90       100       110       120       130       140       150       160       170       180
           AAUA_ALCFA    71 EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISWIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLA 180
               SCOP domains d2ojyd_ D: automated matches                                                                                   SCOP domains
               CATH domains 2ojyD00 D:71-180 Electron Transport Ethylamine Dehydrogenase                                                   CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhh..eee.hhhh...........ee....eeeeee......eeeeee.eee........eee......hhhhhhhh.............eeee..eeeee. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------- Transcript
                 2ojy D  71 EVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISwIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGLA 180
                                    80        90       100       110       120       130       140       150       160       170       180
                                                                109-TRQ                                                                   


Chain H from PDB  Type:PROTEIN  Length:119
 aligned with AAUA_ALCFA | P84887 from UniProtKB/Swiss-Prot  Length:182

    Alignment length:119
                                    70        80        90       100       110       120       130       140       150       160       170         
           AAUA_ALCFA    61 SLNPDLANEDEVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISWIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL 179
               SCOP domains d2ojyh_ H: automated matches                                                                                            SCOP domains
               CATH domains 2ojyH00 H:61-179 Electron Transport Ethylamine Dehydrogenase                                                            CATH domains
           Pfam domains (1) --Me-amine-dh_L-2ojyH01 H:63-179                                                                                        Pfam domains (1)
           Pfam domains (2) --Me-amine-dh_L-2ojyH02 H:63-179                                                                                        Pfam domains (2)
         Sec.struct. author ..hhhhhhhhhhh..........eee.hhhh...........ee....eeeeeee....eeeeeee.eee........eee......hhhhhhhh.............eeee..eeee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------- Transcript
                 2ojy H  61 SLNPDLANEDEVNSCDYWRHCAVDGFLCSCCGGTTTTCPPGSTPSPISwIGTCHNPHDGKDYLISYHDCCGKTACGRCQCNTQTRERPGYEFFLHNDVNWCMANENSTFHCTTSVLVGL 179
                                    70        80        90       100       110       120       130       140       150       160       170         
                                                                          109-TRQ
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Small proteins (3458)

(-) CATH Domains  (1, 2)

Asymmetric/Biological Unit
(-)
Class: Mainly Beta (13760)

(-) Pfam Domains  (2, 4)

Asymmetric/Biological Unit
(-)
Clan: Beta_propeller (192)
(-)
Clan: no clan defined [family: Me-amine-dh_L] (16)

(-) Gene Ontology  (7, 12)

Asymmetric/Biological Unit(hide GO term definitions)
Chain A,B   (AAUB_ALCFA | P84888)
molecular function
    GO:0030058    amine dehydrogenase activity    Catalysis of the reaction: R-CH2-NH2 + H2O + acceptor = R-CHO + NH3 + reduced acceptor.
    GO:0030059    aralkylamine dehydrogenase (azurin) activity    Catalysis of the reaction: H(2)O + arCH(2)NH(2) + 2 azurin = 2 reduced azurin + ArCHO + NH(3). The symbol arCH(2)NH(2) represents an aralkylamine and ArCHO is an aryl aldehyde.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
biological process
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
    GO:0042597    periplasmic space    The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).

Chain D,H   (AAUA_ALCFA | P84887)
molecular function
    GO:0030058    amine dehydrogenase activity    Catalysis of the reaction: R-CH2-NH2 + H2O + acceptor = R-CHO + NH3 + reduced acceptor.
    GO:0030059    aralkylamine dehydrogenase (azurin) activity    Catalysis of the reaction: H(2)O + arCH(2)NH(2) + 2 azurin = 2 reduced azurin + ArCHO + NH(3). The symbol arCH(2)NH(2) represents an aralkylamine and ArCHO is an aryl aldehyde.
    GO:0016491    oxidoreductase activity    Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.
    GO:0016638    oxidoreductase activity, acting on the CH-NH2 group of donors    Catalysis of an oxidation-reduction (redox) reaction in which a CH-NH2 group acts as a hydrogen or electron donor and reduces a hydrogen or electron acceptor.
biological process
    GO:0009308    amine metabolic process    The chemical reactions and pathways involving any organic compound that is weakly basic in character and contains an amino or a substituted amino group. Amines are called primary, secondary, or tertiary according to whether one, two, or three carbon atoms are attached to the nitrogen atom.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.
cellular component
    GO:0042597    periplasmic space    The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    TRQ  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    TSR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Gly A:309 - Pro A:310   [ RasMol ]  
    Gly B:309 - Pro B:310   [ RasMol ]  
    Ser A:200 - Pro A:201   [ RasMol ]  
    Ser B:200 - Pro B:201   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2ojy
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  AAUA_ALCFA | P84887
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  AAUB_ALCFA | P84888
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  1.4.99.4
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  AAUA_ALCFA | P84887
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  AAUB_ALCFA | P84888
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        AAUA_ALCFA | P84887: 2agl 2agw 2agx 2agy 2agz 2ah0 2ah1 2h3x 2h47 2hj4 2hjb 2hkm 2hkr 2hxc 2i0r 2i0s 2i0t 2iaa 2iup 2iuq 2iur 2iuv 2oiz 2ok4 2ok6 2q7q
        AAUB_ALCFA | P84888: 2agl 2agw 2agx 2agy 2agz 2ah0 2ah1 2h3x 2h47 2hj4 2hjb 2hkm 2hkr 2hxc 2i0r 2i0s 2i0t 2iaa 2iup 2iuq 2iur 2iuv 2oiz 2ok4 2ok6 2q7q

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2OJY)