![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (1, 4)
|
(no "Site" information available for 2OFY) |
(no "SS Bond" information available for 2OFY) |
Asymmetric/Biological Unit
|
(no "SAP(SNP)/Variant" information available for 2OFY) |
(no "PROSITE Motif" information available for 2OFY) |
(no "Exon" information available for 2OFY) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:82 aligned with Q0S9B8_RHOJR | Q0S9B8 from UniProtKB/TrEMBL Length:86 Alignment length:82 12 22 32 42 52 62 72 82 Q0S9B8_RHOJR 3 RVPLTAEELERGQRLGELLRSARGDMSMVTVAFDAGISVETLRKIETGRIATPAFFTIAAVARVLDLSLDDVAAVVTFGPVS 84 SCOP domains d2ofya1 A:3-84 Putative transcriptional regulator RHA1_ro04071 SCOP domains CATH domains ----2ofyA01 A:7-76 lambda repressor-like DNA-binding domains -------- CATH domains Pfam domains ---------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ---------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------- Transcript 2ofy A 3 RVPLTAEELERGQRLGELLRSARGDmSmVTVAFDAGISVETLRKIETGRIATPAFFTIAAVARVLDLSLDDVAAVVTFGPVS 84 12 22 | |32 42 52 62 72 82 28-MSE 30-MSE Chain B from PDB Type:PROTEIN Length:80 aligned with Q0S9B8_RHOJR | Q0S9B8 from UniProtKB/TrEMBL Length:86 Alignment length:80 14 24 34 44 54 64 74 84 Q0S9B8_RHOJR 5 PLTAEELERGQRLGELLRSARGDMSMVTVAFDAGISVETLRKIETGRIATPAFFTIAAVARVLDLSLDDVAAVVTFGPVS 84 SCOP domains d2ofyb_ B: Putative transcriptional regulator RHA1_ro04071 SCOP domains CATH domains --2ofyB01 B:7-76 lambda repressor-like DNA-binding domains -------- CATH domains Pfam domains -------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) -------------------------------------------------------------------------------- SAPs(SNPs) PROSITE -------------------------------------------------------------------------------- PROSITE Transcript -------------------------------------------------------------------------------- Transcript 2ofy B 5 PLTAEELERGQRLGELLRSARGDmSmVTVAFDAGISVETLRKIETGRIATPAFFTIAAVARVLDLSLDDVAAVVTFGPVS 84 14 24 | | 34 44 54 64 74 84 28-MSE 30-MSE
|
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit |
(no "Pfam Domain" information available for 2OFY) |
Asymmetric/Biological Unit(hide GO term definitions) Chain A,B (Q0S9B8_RHOJR | Q0S9B8)
|
|
|
|
|
|
|