|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric/Biological Unit (1, 6)
|
(no "Site" information available for 2ODM) |
(no "SS Bond" information available for 2ODM) |
Asymmetric/Biological Unit
|
(no "SAP(SNP)/Variant" information available for 2ODM) |
(no "PROSITE Motif" information available for 2ODM) |
(no "Exon" information available for 2ODM) |
Asymmetric/Biological UnitChain A from PDB Type:PROTEIN Length:79 aligned with Y995_STAAW | Q7A161 from UniProtKB/Swiss-Prot Length:91 Alignment length:83 14 24 34 44 54 64 74 84 Y995_STAAW 5 ATMKNAALKQLTKDADEILHLIKVQLDNLTLPSCPLYEEVLDTQMFGLQKEVDFAVKLGLVDREDGKQIMLRLEKELSKLHEA 87 SCOP domains d2odma_ A: automated matches SCOP domains CATH domains ----------------------------------------------------------------------------------- CATH domains Pfam domains ----------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ----------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ----------------------------------------------------------------------------------- PROSITE Transcript ----------------------------------------------------------------------------------- Transcript 2odm A 5 ATmKNAALKQLTKDADEILHLIKVQLDNL----CPLYEEVLDTQmFGLQKEVDFAVKLGLVDREDGKQImLRLEKELSKLHEA 87 | 14 24 |- | 44 | 54 64 74 84 | 33 38 49-MSE 74-MSE 7-MSE Chain B from PDB Type:PROTEIN Length:83 aligned with Y995_STAAW | Q7A161 from UniProtKB/Swiss-Prot Length:91 Alignment length:88 13 23 33 43 53 63 73 83 Y995_STAAW 4 QATMKNAALKQLTKDADEILHLIKVQLDNLTLPSCPLYEEVLDTQMFGLQKEVDFAVKLGLVDREDGKQIMLRLEKELSKLHEAFTLV 91 SCOP domains d2odmb_ B: automated matches SCOP domains CATH domains ---------------------------------------------------------------------------------------- CATH domains Pfam domains (1) DUF1507-2odmB01 B:4-91 Pfam domains (1) Pfam domains (2) DUF1507-2odmB02 B:4-91 Pfam domains (2) SAPs(SNPs) ---------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ---------------------------------------------------------------------------------------- PROSITE Transcript ---------------------------------------------------------------------------------------- Transcript 2odm B 4 QATmKNAALKQLTKDADEILHLIKVQLDN-----CPLYEEVLDTQmFGLQKEVDFAVKLGLVDREDGKQImLRLEKELSKLHEAFTLV 91 | 13 23 |- | 43 | 53 63 73| 83 7-MSE 32 38 49-MSE 74-MSE
|
Asymmetric/Biological Unit |
(no "CATH Domain" information available for 2ODM) |
Asymmetric/Biological Unit
|
Asymmetric/Biological Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2ODM)
|
|
|
|
|
|
|