|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (1, 1)
Asymmetric Unit (1, 1)
|
Sites (1, 1)
Asymmetric Unit (1, 1)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2O90) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2O90) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2O90) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2O90) |
Exons (0, 0)| (no "Exon" information available for 2O90) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:115 aligned with FOLB_ECOLI | P0AC16 from UniProtKB/Swiss-Prot Length:122 Alignment length:115 10 20 30 40 50 60 70 80 90 100 110 FOLB_ECOLI 1 MDIVFIEQLSVITTIGVYDWEQTIEQKLVFDIEMAWDNRKAAKSDDVADCLSYADIAETVVSHVEGARFALVERVAEEVAELLLARFNSPWVRIKLSKPGAVARAANVGVIIERG 115 SCOP domains ------------------------------------------------------------------------------------------------------------------- SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------------- CATH domains Pfam domains ---FolB-2o90A01 A:4-114 - Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------------------------------------------- Transcript 2o90 A 1 MDIVFIEQLSVITTIGVYDWEQTIEQKLVFDIEMAWDNRKAAKSDDVADCLSYADIAETVVSHVEGARFALVERVAEEVAELLLARFNSPWVRIKLSKPGAVARAANVGVIIERG 115 10 20 30 40 50 60 70 80 90 100 110
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2O90) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2O90) |
Pfam Domains (1, 1)| Asymmetric Unit |
Gene Ontology (7, 7)|
Asymmetric Unit(hide GO term definitions) Chain A (FOLB_ECOLI | P0AC16)
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|