![]() |
|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (3, 16)
|
Asymmetric Unit (4, 4)
|
(no "SS Bond" information available for 2O3L) |
(no "Cis Peptide Bond" information available for 2O3L) |
(no "SAP(SNP)/Variant" information available for 2O3L) |
(no "PROSITE Motif" information available for 2O3L) |
(no "Exon" information available for 2O3L) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:83 aligned with Q734F7_BACC1 | Q734F7 from UniProtKB/TrEMBL Length:113 Alignment length:86 19 29 39 49 59 69 79 89 Q734F7_BACC1 10 GDKKEYKMMMARVAALPEDYQFVFKKIQNYMWNFSAGNGMDMLHIQYELIDLFEAGAAEGRQVLDITGEDVASFADELVANAKTYV 95 SCOP domains ----d2o3la1 A:14-95 Hypothetical protein BCE3448 SCOP domains CATH domains 2 o3lA00 A:13-95 c-terminal domain of poly(a) binding protein CATH domains Pfam domains -------------------------------------------------------------------------------------- Pfam domains Chain B from PDB Type:PROTEIN Length:81 aligned with Q734F7_BACC1 | Q734F7 from UniProtKB/TrEMBL Length:113 Alignment length:81 23 33 43 53 63 73 83 93 Q734F7_BACC1 14 EYKMMMARVAALPEDYQFVFKKIQNYMWNFSAGNGMDMLHIQYELIDLFEAGAAEGRQVLDITGEDVASFADELVANAKTY 94 SCOP domains d2o3lb_ B: Hypothetical protein BCE3448 SCOP domains CATH domains 2o3lB00 B:14-94 c-terminal domain of poly(a) binding protein CATH domains Pfam domains (1) DUF1048-2o3lB01 B:14-94 Pfam domains (1) Pfam domains (2) DUF1048-2o3lB02 B:14-94 Pfam domains (2) SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------- Transcript 2o3l B 14 EYKmmmARVAALPEDYQFVFKKIQNYmWNFSAGNGmDmLHIQYELIDLFEAGAAEGRQVLDITGEDVASFADELVANAKTY 94 ||| 23 33 | 43 | |53 63 73 83 93 17-MSE 40-MSE 49-MSE 18-MSE 51-MSE 19-MSE
|
Asymmetric Unit
|
Asymmetric Unit
|
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions) Chain A,B (Q734F7_BACC1 | Q734F7)
|
|
|
|
|
|
|