|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (2, 8)| Asymmetric Unit (2, 8) Biological Unit 1 (1, 12) |
Sites (2, 2)
Asymmetric Unit (2, 2)
|
SS Bonds (0, 0)| (no "SS Bond" information available for 2O35) |
Cis Peptide Bonds (0, 0)| (no "Cis Peptide Bond" information available for 2O35) |
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2O35) |
PROSITE Motifs (0, 0)| (no "PROSITE Motif" information available for 2O35) |
Exons (0, 0)| (no "Exon" information available for 2O35) |
Sequences/Alignments
Asymmetric UnitChain A from PDB Type:PROTEIN Length:79 aligned with Q92M60_RHIME | Q92M60 from UniProtKB/TrEMBL Length:101 Alignment length:79 11 21 31 41 51 61 71 Q92M60_RHIME 2 SEISPEQRTAFEAAAFRRLLEHLRERSDVQNIDLMNLAGFCRNCLSNWYREAAEASGVPMSKEESREIVYGMPYEEWRT 80 SCOP domains d2o35a1 A:2-80 Hypothetical protein SMc04008 SCOP domains CATH domains 2o35A00 A:2-80 SMc04008-like domain CATH domains Pfam domains ------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------- SAPs(SNPs) PROSITE ------------------------------------------------------------------------------- PROSITE Transcript ------------------------------------------------------------------------------- Transcript 2o35 A 2 SEISPEQRTAFEAAVFRRLLEHLRERSDVQNIDLmNLAGFCRNCLSNWYREAAEASGVPmSKEESREIVYGmPYEEWRT 80 11 21 31 | 41 51 61 71 | 36-MSE 61-MSE 73-MSE Chain B from PDB Type:PROTEIN Length:95 aligned with Q92M60_RHIME | Q92M60 from UniProtKB/TrEMBL Length:101 Alignment length:96 11 21 31 41 51 61 71 81 91 Q92M60_RHIME 2 SEISPEQRTAFEAAAFRRLLEHLRERSDVQNIDLMNLAGFCRNCLSNWYREAAEASGVPMSKEESREIVYGMPYEEWRTQNQGEASPEQKAAFERN 97 SCOP domains d2o35b_ B: Hypothetical protein SMc04008 SCOP domains CATH domains 2o35B00 B:2-97 SMc04008-like domain CATH domains Pfam domains (1) ----------------------------DUF1244-2o35B01 B:30-97 Pfam domains (1) Pfam domains (2) ----------------------------DUF1244-2o35B02 B:30-97 Pfam domains (2) SAPs(SNPs) ------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE ------------------------------------------------------------------------------------------------ PROSITE Transcript ------------------------------------------------------------------------------------------------ Transcript 2o35 B 2 SEISPEQRTAFEAAVFRRLLEHLRERSDVQNIDLmNLAGFCRNCLSNWYREAAEASGVPmSKEESREIVYGmPYEEWRTQN-GEASPEQKAAFERN 97 11 21 31 | 41 51 61 71 | 81| | 91 36-MSE 61-MSE 73-MSE 82 | 84
|
||||||||||||||||||||
SCOP Domains (1, 2)
Asymmetric Unit
|
CATH Domains (1, 2)| Asymmetric Unit |
Pfam Domains (1, 2)
Asymmetric Unit
|
Gene Ontology (1, 1)|
Asymmetric Unit(hide GO term definitions) Chain A,B (Q92M60_RHIME | Q92M60)
|
||||||||||||
Interactive Views
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|