|
|
|
|
|
|
Summary Information (see also Sequences/Alignments below) |
Asymmetric Unit (2, 40) Biological Unit 1 (2, 20) Biological Unit 2 (2, 20) Biological Unit 3 (2, 20) |
Asymmetric Unit (8, 8)
|
(no "SS Bond" information available for 2NWA) |
(no "Cis Peptide Bond" information available for 2NWA) |
(no "SAP(SNP)/Variant" information available for 2NWA) |
(no "PROSITE Motif" information available for 2NWA) |
(no "Exon" information available for 2NWA) |
Asymmetric UnitChain A from PDB Type:PROTEIN Length:80 aligned with YTMB_BACSU | O34365 from UniProtKB/Swiss-Prot Length:80 Alignment length:81 80 10 20 30 40 50 60 70 80 YTMB_BACSU 1 MGMPVEFNTLIVTKGKEVRIDENIFTLEKDGYRVYPMEIPMDVRKTKFGEKSGTAEVQKLQWEEGRTIITYKLTSLHSVN- - SCOP domains d2nwaa1 A:1-80 Hypothetical protein YtmB - SCOP domains CATH domains -2nwaA01 A:2-77 Hypothetical PUA domain-like; do main 1 ---- CATH domains Pfam domains --------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------- Transcript 2nwa A 1 mGmPVEFNTLIVTKGKEVRIDENIFTLEKDGYRVYPmEIPmDVRKTKF-EKSGTAEVQKLQWEEGRTIITYKLTSLHSVNL 81 | | 10 20 30 | 40| |50 60 70 80 | | 37-MSE 48 | 1-MSE 41-MSE 50 3-MSE Chain B from PDB Type:PROTEIN Length:80 aligned with YTMB_BACSU | O34365 from UniProtKB/Swiss-Prot Length:80 Alignment length:81 80 10 20 30 40 50 60 70 80 YTMB_BACSU 1 MGMPVEFNTLIVTKGKEVRIDENIFTLEKDGYRVYPMEIPMDVRKTKFGEKSGTAEVQKLQWEEGRTIITYKLTSLHSVN- - SCOP domains d2nwab_ B: Hypothetical protein YtmB SCOP domains CATH domains -2nwaB01 B:2-77 Hypothetical PUA domain-like; do main 1 ---- CATH domains Pfam domains --------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------- Transcript 2nwa B 1 mGmPVEFNTLIVTKGKEVRIDENIFTLEKDGYRVYPmEIPmDVRKTKF-EKSGTAEVQKLQWEEGRTIITYKLTSLHSVNL 81 | | 10 20 30 | 40| |50 60 70 80 1-MSE 37-MSE 48 | 3-MSE 41-MSE 50 Chain C from PDB Type:PROTEIN Length:80 aligned with YTMB_BACSU | O34365 from UniProtKB/Swiss-Prot Length:80 Alignment length:81 80 10 20 30 40 50 60 70 80 YTMB_BACSU 1 MGMPVEFNTLIVTKGKEVRIDENIFTLEKDGYRVYPMEIPMDVRKTKFGEKSGTAEVQKLQWEEGRTIITYKLTSLHSVN- - SCOP domains d2nwac_ C: Hypothetical protein YtmB SCOP domains CATH domains -2nwaC01 C:2-77 Hypothetical PUA domain-like; do main 1 ---- CATH domains Pfam domains --------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------- Transcript 2nwa C 1 mGmPVEFNTLIVTKGKEVRIDENIFTLEKDGYRVYPmEIPmDVRKTKF-EKSGTAEVQKLQWEEGRTIITYKLTSLHSVNL 81 | | 10 20 30 | 40| |50 60 70 80 1-MSE 37-MSE 48 | 3-MSE 41-MSE 50 Chain D from PDB Type:PROTEIN Length:80 aligned with YTMB_BACSU | O34365 from UniProtKB/Swiss-Prot Length:80 Alignment length:81 80 10 20 30 40 50 60 70 80 YTMB_BACSU 1 MGMPVEFNTLIVTKGKEVRIDENIFTLEKDGYRVYPMEIPMDVRKTKFGEKSGTAEVQKLQWEEGRTIITYKLTSLHSVN- - SCOP domains d2nwad_ D: Hypothetical protein YtmB SCOP domains CATH domains -2nwaD01 D:2-77 Hypothetical PUA domain-like; do main 1 ---- CATH domains Pfam domains --------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------- Transcript 2nwa D 1 mGmPVEFNTLIVTKGKEVRIDENIFTLEKDGYRVYPmEIPmDVRKTKF-EKSGTAEVQKLQWEEGRTIITYKLTSLHSVNL 81 | | 10 20 30 | 40| |50 60 70 80 1-MSE 37-MSE 48 | 3-MSE 41-MSE 50 Chain E from PDB Type:PROTEIN Length:80 aligned with YTMB_BACSU | O34365 from UniProtKB/Swiss-Prot Length:80 Alignment length:81 80 10 20 30 40 50 60 70 80 YTMB_BACSU 1 MGMPVEFNTLIVTKGKEVRIDENIFTLEKDGYRVYPMEIPMDVRKTKFGEKSGTAEVQKLQWEEGRTIITYKLTSLHSVN- - SCOP domains d2nwae_ E: Hypothetical protein YtmB SCOP domains CATH domains -2nwaE01 E:2-77 Hypothetical PUA domain-like; do main 1 ---- CATH domains Pfam domains --------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------- Transcript 2nwa E 1 mGmPVEFNTLIVTKGKEVRIDENIFTLEKDGYRVYPmEIPmDVRKTKF-EKSGTAEVQKLQWEEGRTIITYKLTSLHSVNL 81 | | 10 20 30 | 40| |50 60 70 80 1-MSE 37-MSE 48 | 3-MSE 41-MSE 50 Chain F from PDB Type:PROTEIN Length:80 aligned with YTMB_BACSU | O34365 from UniProtKB/Swiss-Prot Length:80 Alignment length:81 80 10 20 30 40 50 60 70 80 YTMB_BACSU 1 MGMPVEFNTLIVTKGKEVRIDENIFTLEKDGYRVYPMEIPMDVRKTKFGEKSGTAEVQKLQWEEGRTIITYKLTSLHSVN- - SCOP domains d2nwaf_ F: Hypothetical protein YtmB SCOP domains CATH domains -2nwaF01 F:2-77 Hypothetical PUA domain-like; do main 1 ---- CATH domains Pfam domains --------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------- Transcript 2nwa F 1 mGmPVEFNTLIVTKGKEVRIDENIFTLEKDGYRVYPmEIPmDVRKTKF-EKSGTAEVQKLQWEEGRTIITYKLTSLHSVNL 81 | | 10 20 30 | 40| |50 60 70 80 1-MSE 37-MSE 48 | 3-MSE 41-MSE 50 Chain G from PDB Type:PROTEIN Length:80 aligned with YTMB_BACSU | O34365 from UniProtKB/Swiss-Prot Length:80 Alignment length:81 80 10 20 30 40 50 60 70 80 YTMB_BACSU 1 MGMPVEFNTLIVTKGKEVRIDENIFTLEKDGYRVYPMEIPMDVRKTKFGEKSGTAEVQKLQWEEGRTIITYKLTSLHSVN- - SCOP domains d2nwag_ G: Hypothetical protein YtmB SCOP domains CATH domains -2nwaG01 G:2-77 Hypothetical PUA domain-like; do main 1 ---- CATH domains Pfam domains --------------------------------------------------------------------------------- Pfam domains SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------- Transcript 2nwa G 1 mGmPVEFNTLIVTKGKEVRIDENIFTLEKDGYRVYPmEIPmDVRKTKF-EKSGTAEVQKLQWEEGRTIITYKLTSLHSVNL 81 | | 10 20 30 | 40| |50 60 70 80 1-MSE 37-MSE 48 | 3-MSE 41-MSE 50 Chain H from PDB Type:PROTEIN Length:80 aligned with YTMB_BACSU | O34365 from UniProtKB/Swiss-Prot Length:80 Alignment length:81 80 10 20 30 40 50 60 70 80 YTMB_BACSU 1 MGMPVEFNTLIVTKGKEVRIDENIFTLEKDGYRVYPMEIPMDVRKTKFGEKSGTAEVQKLQWEEGRTIITYKLTSLHSVN- - SCOP domains d2nwah_ H: Hypothetical protein YtmB SCOP domains CATH domains -2nwaH01 H:2-77 Hypothetical PUA domain-like; do main 1 ---- CATH domains Pfam domains (1) DUF2584-2nwaH01 H:1-80 - Pfam domains (1) Pfam domains (2) DUF2584-2nwaH02 H:1-80 - Pfam domains (2) Pfam domains (3) DUF2584-2nwaH03 H:1-80 - Pfam domains (3) Pfam domains (4) DUF2584-2nwaH04 H:1-80 - Pfam domains (4) Pfam domains (5) DUF2584-2nwaH05 H:1-80 - Pfam domains (5) Pfam domains (6) DUF2584-2nwaH06 H:1-80 - Pfam domains (6) Pfam domains (7) DUF2584-2nwaH07 H:1-80 - Pfam domains (7) Pfam domains (8) DUF2584-2nwaH08 H:1-80 - Pfam domains (8) SAPs(SNPs) --------------------------------------------------------------------------------- SAPs(SNPs) PROSITE --------------------------------------------------------------------------------- PROSITE Transcript --------------------------------------------------------------------------------- Transcript 2nwa H 1 mGmPVEFNTLIVTKGKEVRIDENIFTLEKDGYRVYPmEIPmDVRKTKF-EKSGTAEVQKLQWEEGRTIITYKLTSLHSVNL 81 | | 10 20 30 | 40| |50 60 70 80 1-MSE 37-MSE 48 | 3-MSE 41-MSE 50
|
Asymmetric Unit |
Asymmetric Unit |
Asymmetric Unit
|
Asymmetric Unit(hide GO term definitions)
(no "Gene Ontology" information available for 2NWA)
|
|
|
|
|
|
|