Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Biol.Unit 1 - manually
(-)Asym.Unit - manually
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
collapse expand < >
Image Biol.Unit 1 - manually
Biol.Unit 1 - manually  (Jmol Viewer)
Image Asym.Unit - manually
Asym.Unit - manually  (Jmol Viewer)
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)

(-) Description

Title :  MALARIAL ENOYL ACYL ACP REDUCTASE BOUND WITH INH-NAD ADDUCT
 
Authors :  J. S. Freundlich, M. Yu, E. Lucumi, M. Kuo, H. C. Tsai, J. C. Valderramos, L. Karagyozov, W. R. Jacobs Jr. , G. A. Schiehser, D. A. Fidock, D. P. Ja J. C. Sacchettini
Date :  30 Oct 06  (Deposition) - 17 Jul 07  (Release) - 13 Jul 11  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.50
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A,B,C,D  (2x)
Keywords :  Pfenr; Inh; Malaria, Oxidoreductase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  J. S. Freundlich, F. Wang, H. C. Tsai, M. Kuo, H. M. Shieh, J. W. Anderson L. J. Nkrumah, J. C. Valderramos, M. Yu, T. R. Kumar, S. G. Valderramos, W. R. Jacobs, G. A. Schiehser, D. P. Jacobus, D. A. Fidock, J. C. Sacchettini
X-Ray Structural Analysis Of Plasmodium Falciparum Enoyl Acyl Carrier Protein Reductase As A Pathway Toward The Optimization Of Triclosan Antimalarial Efficacy
J. Biol. Chem. V. 282 25436 2007
PubMed-ID: 17567585  |  Reference-DOI: 10.1074/JBC.M701813200

(-) Compounds

Molecule 1 - ENOYL-ACYL CARRIER REDUCTASE
    ChainsA, B
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneFABI
    Organism CommonMALARIA PARASITE P. FALCIPARUM
    Organism ScientificPLASMODIUM FALCIPARUM
    Organism Taxid5833
    SynonymENOYL-ACP REDUCTASE
 
Molecule 2 - ENOYL-ACYL CARRIER REDUCTASE
    ChainsC, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneFABI
    Organism CommonMALARIA PARASITE P. FALCIPARUM
    Organism ScientificPLASMODIUM FALCIPARUM
    Organism Taxid5833
    SynonymENOYL-ACP REDUCTASE

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit ABCD
Biological Unit 1 (2x)ABCD

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 2)

Asymmetric Unit (1, 2)
No.NameCountTypeFull Name
1ZID2Ligand/IonISONICOTINIC-ACETYL-NICOTINAMIDE-ADENINE DINUCLEOTIDE
Biological Unit 1 (1, 4)
No.NameCountTypeFull Name
1ZID4Ligand/IonISONICOTINIC-ACETYL-NICOTINAMIDE-ADENINE DINUCLEOTIDE

(-) Sites  (2, 2)

Asymmetric Unit (2, 2)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREGLY B:104 , ILE B:105 , GLY B:106 , GLY B:110 , TYR B:111 , TRP B:131 , PHE B:167 , ASP B:168 , ALA B:169 , SER B:215 , LEU B:216 , ALA B:217 , ASN B:218 , LEU B:265 , THR B:266 , TYR B:267 , LYS B:285 , ALA B:312 , GLY B:313 , PRO B:314 , LEU B:315 , SER B:317 , ALA B:319 , HOH B:451 , HOH B:462 , HOH B:481 , HOH B:493 , HOH B:499 , PHE D:368 , ALA D:372BINDING SITE FOR RESIDUE ZID B 450
2AC2SOFTWAREGLY A:104 , ILE A:105 , GLY A:106 , GLY A:110 , TYR A:111 , TRP A:131 , PHE A:167 , ASP A:168 , ALA A:169 , SER A:215 , LEU A:216 , ALA A:217 , ASN A:218 , LEU A:265 , THR A:266 , TYR A:267 , LYS A:285 , GLY A:313 , PRO A:314 , LEU A:315 , SER A:317 , ALA A:319 , ALA A:320 , HOH A:556 , HOH A:561 , HOH A:570 , PHE C:368 , ALA C:372BINDING SITE FOR RESIDUE ZID A 550

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2NQ8)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2NQ8)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2NQ8)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2NQ8)

(-) Exons   (0, 0)

(no "Exon" information available for 2NQ8)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:229
 aligned with Q9BJJ9_PLAFA | Q9BJJ9 from UniProtKB/TrEMBL  Length:432

    Alignment length:229
                                   106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316         
         Q9BJJ9_PLAFA    97 EDICFIAGIGDTNGYGWGIAKELSKRNVKIIFGIWPPVYNIFMKNYKNGKFDNDMIIDKDKKMNILDMLPFDASFDTANDIDEETKNNKRYNMLQNYTIEDVANLIHQKYGKINMLVHSLANAKEVQKDLLNTSRKGYLDALSKSSYSLISLCKYFVNIMKPQSSIISLTYHASQKVVPGYGGGMSSAKAALESDTRVLAYHLGRNYNIRINTISAGPLKSRAATAINK 325
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2nq8A00 A:97-325 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                  CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eeeeeee....hhhhhhhhhhhhh..eeeeeehhhhhhhhhhhhhh..hhhhhee...ee..eeeeee......hhhhhhhhhhh..........hhhhhhhhhhhhhh.eeeeee..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeeeeeeehhhhh........hhhhhhhhhhhhhhhhhhhhhhhh..eeeeeee............. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2nq8 A  97 EDICFIAGIGDTNGYGWGIAKELSKRNVKIIFGIWPPVYNIFMKNYKNGKFDNDMIIDKDKKMNILDMLPFDASFDTANDIDEETKNNKRYNMLQNYTIEDVANLIHQKYGKINMLVHSLANAKEVQKDLLNTSRKGYLDALSKSSYSLISLCKYFVNIMKPQSSIISLTYHASQKVVPGYGGGMSSAKAALESDTRVLAYHLGRNYNIRINTISAGPLKSRAATAINK 325
                                   106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316         

Chain B from PDB  Type:PROTEIN  Length:229
 aligned with Q9BJJ9_PLAFA | Q9BJJ9 from UniProtKB/TrEMBL  Length:432

    Alignment length:229
                                   106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316         
         Q9BJJ9_PLAFA    97 EDICFIAGIGDTNGYGWGIAKELSKRNVKIIFGIWPPVYNIFMKNYKNGKFDNDMIIDKDKKMNILDMLPFDASFDTANDIDEETKNNKRYNMLQNYTIEDVANLIHQKYGKINMLVHSLANAKEVQKDLLNTSRKGYLDALSKSSYSLISLCKYFVNIMKPQSSIISLTYHASQKVVPGYGGGMSSAKAALESDTRVLAYHLGRNYNIRINTISAGPLKSRAATAINK 325
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains 2nq8B00 B:97-325 NAD(P)-binding Rossmann-like Domain                                                                                                                                                                                  CATH domains
           Pfam domains (1) -------adh_short_C2-2nq8B01 B:104-325                                                                                                                                                                                                 Pfam domains (1)
           Pfam domains (2) -------adh_short_C2-2nq8B02 B:104-325                                                                                                                                                                                                 Pfam domains (2)
         Sec.struct. author ..eeeee......hhhhhhhhhhhhh..eeeeeehhhhhhhhhhhhhh..hhhhh.........eeeeee......hhhhhhhhhhhh.........hhhhhhhhhhhhhh.eeeeee..........hhhhhhhhhhhhhhhhhhhhhhhhhhhhh..eeeeeeeeeeehhhhh........hhhhhhhhhhhhhhhhhhhhhhhhh.eeeeeee....hhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2nq8 B  97 EDICFIAGIGDTNGYGWGIAKELSKRNVKIIFGIWPPVYNIFMKNYKNGKFDNDMIIDKDKKMNILDMLPFDASFDTANDIDEETKNNKRYNMLQNYTIEDVANLIHQKYGKINMLVHSLANAKEVQKDLLNTSRKGYLDALSKSSYSLISLCKYFVNIMKPQSSIISLTYHASQKVVPGYGGGMSSAKAALESDTRVLAYHLGRNYNIRINTISAGPLKSRAATAINK 325
                                   106       116       126       136       146       156       166       176       186       196       206       216       226       236       246       256       266       276       286       296       306       316         

Chain C from PDB  Type:PROTEIN  Length:60
 aligned with Q9BH77_PLAFA | Q9BH77 from UniProtKB/TrEMBL  Length:432

    Alignment length:60
                                   375       385       395       405       415       425
         Q9BH77_PLAFA   366 YTFIDYAIEYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNGLNIMFLPDD 425
               SCOP domains ------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------ Pfam domains
         Sec.struct. author hhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.....eeee..hhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------ Transcript
                 2nq8 C 366 YTFIDYAIEYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNGLNIMFLPDD 425
                                   375       385       395       405       415       425

Chain D from PDB  Type:PROTEIN  Length:60
 aligned with Q9BH77_PLAFA | Q9BH77 from UniProtKB/TrEMBL  Length:432

    Alignment length:60
                                   375       385       395       405       415       425
         Q9BH77_PLAFA   366 YTFIDYAIEYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNGLNIMFLPDD 425
               SCOP domains ------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------ CATH domains
           Pfam domains (1) adh_short_C2-2nq8D01 D:366-418                       ------- Pfam domains (1)
           Pfam domains (2) adh_short_C2-2nq8D02 D:366-418                       ------- Pfam domains (2)
         Sec.struct. author hhhhhhhhhhhhhhh......hhhhhhhhhhhhhhhhhh.....eeee..hhhhh..... Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------ Transcript
                 2nq8 D 366 YTFIDYAIEYSEKYAPLRQKLLSTDIGSVASFLLSRESRAITGQTIYVDNGLNIMFLPDD 425
                                   375       385       395       405       415       425

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2NQ8)

(-) CATH Domains  (1, 2)

Asymmetric Unit
(-)
Class: Alpha Beta (26913)

(-) Pfam Domains  (1, 4)

Asymmetric Unit

(-) Gene Ontology  (4, 8)

Asymmetric Unit(hide GO term definitions)
Chain A,B   (Q9BJJ9_PLAFA | Q9BJJ9)
molecular function
    GO:0004318    enoyl-[acyl-carrier-protein] reductase (NADH) activity    Catalysis of the reaction: acyl-[acyl-carrier protein] + NAD+ = trans-2,3-dehydroacyl-[acyl-carrier protein] + NADH + H+.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
    GO:0006633    fatty acid biosynthetic process    The chemical reactions and pathways resulting in the formation of a fatty acid, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils. Fatty acids are predominantly straight-chain acids of 4 to 24 carbon atoms, which may be saturated or unsaturated; branched fatty acids and hydroxy fatty acids also occur, and very long chain acids of over 30 carbons are found in waxes.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

Chain C,D   (Q9BH77_PLAFA | Q9BH77)
molecular function
    GO:0004318    enoyl-[acyl-carrier-protein] reductase (NADH) activity    Catalysis of the reaction: acyl-[acyl-carrier protein] + NAD+ = trans-2,3-dehydroacyl-[acyl-carrier protein] + NADH + H+.
    GO:0000166    nucleotide binding    Interacting selectively and non-covalently with a nucleotide, any compound consisting of a nucleoside that is esterified with (ortho)phosphate or an oligophosphate at any hydroxyl group on the ribose or deoxyribose.
biological process
    GO:0006633    fatty acid biosynthetic process    The chemical reactions and pathways resulting in the formation of a fatty acid, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils. Fatty acids are predominantly straight-chain acids of 4 to 24 carbon atoms, which may be saturated or unsaturated; branched fatty acids and hydroxy fatty acids also occur, and very long chain acids of over 30 carbons are found in waxes.
    GO:0055114    oxidation-reduction process    A metabolic process that results in the removal or addition of one or more electrons to or from a substance, with or without the concomitant removal or addition of a proton or protons.

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    ZID  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2nq8)
 
Biological Unit
  Complete Structure
    Biological Unit 1  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2nq8
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q9BH77_PLAFA | Q9BH77
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
  Q9BJJ9_PLAFA | Q9BJJ9
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q9BH77_PLAFA | Q9BH77
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Q9BJJ9_PLAFA | Q9BJJ9
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        Q9BH77_PLAFA | Q9BH772ol4 2oos
UniProtKB/TrEMBL
        Q9BH77_PLAFA | Q9BH771nhg 1nhw 1nnu 1vrw 1zw1 2o2y 2op0 2op1
        Q9BJJ9_PLAFA | Q9BJJ91uh5 1v35 1zsn 1zxb 1zxl 2ol4 2oos 3am3 3am4 3am5 3lsy 3lt0 3lt1 3lt2 3lt4

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2NQ8)