Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NMR STRUCTURE OF THE MYRISTYLATED FELINE IMMUNODEFICIENCY VIRUS MATRIX PROTEIN
 
Authors :  L. A. Brown, C. Cox, R. J. Button, J. Baptiste, K. Bahlow, V. Spurrier, B. L. Kuo, E. O. Freed, M. F. Summers, J. Kyser, H. R. Summers
Date :  15 Apr 15  (Deposition) - 27 May 15  (Release) - 27 May 15  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
NMR Structure *:  A  (1x)
Keywords :  Myristoylated, Fiv, Hiv, Siv, Feline, Matrix, P15, Viral Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  L. A. Brown, C. Cox, J. Baptiste, H. Summers, R. Button, K. Bahlow, V. Spurrier, J. Kyser, B. G. Luttge, L. Kuo, E. O. Freed, M. F. Summers
Nmr Structure Of The Myristylated Feline Immunodeficiency Virus Matrix Protein.
Viruses V. 7 2210 2015
PubMed-ID: 25941825  |  Reference-DOI: 10.3390/V7052210

(-) Compounds

Molecule 1 - MATRIX PROTEIN P15
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21(DE3) RIL
    Expression System Taxid469008
    Expression System VectorPET11/PET17
    Expression System Vector TypePLASMID
    GeneGAG
    MutationYES
    Organism CommonFIV
    Organism ScientificFELINE IMMUNODEFICIENCY VIRUS (ISOLATE PETALUMA)
    Organism Taxid11674
    StrainPETALUMA STRAIN
    VariantCLONE 34TF10

 Structural Features

(-) Chains, Units

  1
NMR Structure (20x)A
NMR Structure * (1x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 1)

NMR Structure (1, 1)
No.NameCountTypeFull Name
1MYR1Mod. Amino AcidMYRISTIC ACID
NMR Structure * (1, 1)
No.NameCountTypeFull Name
1MYR1Mod. Amino AcidMYRISTIC ACID

(-) Sites  (0, 0)

(no "Site" information available for 2N1R)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2N1R)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2N1R)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2N1R)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2N1R)

(-) Exons   (0, 0)

(no "Exon" information available for 2N1R)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:135
                                                                                                                                                                       
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhh.............hhhhhhhhhhhhhhhh.........hhhhhhhhhhhhhhhhhhhh.hhhhhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhh..................... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 2n1r A   1 xGNGASRDWKMAIKRCSNVAVGVGGKSKKFGEGNFRWAIRMANVSTGREPGDIPETLDQLRLVICDLQERREKFGSSKEIDMAIVTLKVFAVAGLLNMTVSTAAAAENMYSQMGLDTRPSMKEAGGKEEGPPQAY 135
                            |       10        20        30        40        50        60        70        80        90       100       110       120       130     
                            |                                                                                                                                      
                            1-MYR                                                                                                                                  

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2N1R)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2N1R)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2N1R)

(-) Gene Ontology  (11, 11)

NMR Structure(hide GO term definitions)

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    MYR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
(no "Sites" information available for 2n1r)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2n1r)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2n1r
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  GAG_FIVPE | P16087
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  GAG_FIVPE | P16087
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        GAG_FIVPE | P160874ic9 4ica 5dck

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2N1R)