Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - model 1, sites
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - model 1, sites
NMR Structure - model 1, sites  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF OXIDIZED TRIHEME CYTOCHROME PPCA FROM GEOBACTER SULFURREDUCENS
 
Authors :  L. Morgado, M. Bruix, R. Pokkuluri, C. A. Salgueiro, D. L. Turner
Date :  08 Feb 15  (Deposition) - 10 Feb 16  (Release) - 15 Mar 17  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (20x)
NMR Structure *:  A  (1x)
Keywords :  Cytochrome, Paramagnetic, Electron Transport (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  L. Morgado, M. Bruix, P. R. Pokkuluri, C. A. Salgueiro, D. L. Turner
Redox- And Ph-Linked Conformational Changes In Triheme Cytochrome Ppca From Geobacter Sulfurreducens.
Biochem. J. V. 474 231 2017
PubMed-ID: 28062839  |  Reference-DOI: 10.1042/BCJ20160932

(-) Compounds

Molecule 1 - PPCA
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainBL21
    Expression System Taxid562
    Expression System VectorPCK32
    FragmentUNP RESIDUES 21-91
    GenePPCA
    Organism ScientificGEOBACTER SULFURREDUCENS
    Organism Taxid35554

 Structural Features

(-) Chains, Units

  1
NMR Structure (20x)A
NMR Structure * (1x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 3)

NMR Structure (1, 3)
No.NameCountTypeFull Name
1HEC3Ligand/IonHEME C
NMR Structure * (1, 3)
No.NameCountTypeFull Name
1HEC3Ligand/IonHEME C

(-) Sites  (3, 3)

NMR Structure (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREILE A:4 , LEU A:6 , HIS A:17 , GLN A:21 , CYS A:27 , CYS A:30 , HIS A:31 , LYS A:37 , ILE A:38 , HEC A:102BINDING SITE FOR RESIDUE HEC A 101
2AC2SOFTWARELEU A:6 , VAL A:13 , PHE A:15 , PRO A:16 , HIS A:20 , ALA A:23 , LYS A:29 , CYS A:51 , CYS A:54 , HIS A:55 , MET A:58 , LYS A:60 , PRO A:62 , CYS A:68 , HEC A:101BINDING SITE FOR RESIDUE HEC A 102
3AC3SOFTWARELEU A:6 , LYS A:7 , LYS A:9 , ASN A:10 , PHE A:41 , LYS A:43 , ALA A:46 , HIS A:47 , THR A:63 , LYS A:64 , CYS A:65 , CYS A:68 , HIS A:69BINDING SITE FOR RESIDUE HEC A 103

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2MZ9)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2MZ9)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2MZ9)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2MZ9)

(-) Exons   (0, 0)

(no "Exon" information available for 2MZ9)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:71
 aligned with Q8GGK7_GEOSN | Q8GGK7 from UniProtKB/TrEMBL  Length:91

    Alignment length:71
                                    30        40        50        60        70        80        90 
          Q8GGK7_GEOSN   21 ADDIVLKAKNGDVKFPHKAHQKAVPDCKKCHEKGPGKIEGFGKEMAHGKGCKGCHEEMKKGPTKCGECHKK 91
               SCOP domains ----------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..eee......eeeeehhhhh....................hhhhhhh..hhhhhhhhh....hhhhhee. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------- Transcript
                  2mz9 A  1 ADDIVLKAKNGDVKFPHKAHQKAVPDCKKCHEKGPGKIEGFGKEMAHGKGCKGCHEEMKKGPTKCGECHKK 71
                                    10        20        30        40        50        60        70 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2MZ9)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2MZ9)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2MZ9)

(-) Gene Ontology  (4, 4)

NMR Structure(hide GO term definitions)
Chain A   (Q8GGK7_GEOSN | Q8GGK7)
molecular function
    GO:0009055    electron carrier activity    Any molecular entity that serves as an electron acceptor and electron donor in an electron transport chain. An electron transport chain is a process in which a series of electron carriers operate together to transfer electrons from donors to any of several different terminal electron acceptors to generate a transmembrane electrochemical gradient.
    GO:0020037    heme binding    Interacting selectively and non-covalently with heme, any compound of iron complexed in a porphyrin (tetrapyrrole) ring.
    GO:0046872    metal ion binding    Interacting selectively and non-covalently with any metal ion.
biological process
    GO:0006791    sulfur utilization    A series of processes that forms an integrated mechanism by which a cell or an organism detects the depletion of primary sulfur sources and then activates genes to scavenge the last traces of the primary sulfur source and to transport and metabolize alternate sulfur sources. The utilization process begins when the cell or organism detects sulfur levels, includes the activation of genes whose products detect, transport or metabolize sulfur-containing compounds, and ends when the sulfur is incorporated into the cell or organism's metabolism.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    HEC  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2mz9)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2mz9
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8GGK7_GEOSN | Q8GGK7
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q8GGK7_GEOSN | Q8GGK7
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q8GGK7_GEOSN | Q8GGK71os6 2ldo 2n91 3sel 3sj0 3sj1 3sj4 4haj 4hb6 4hb8 4hbf 4hc3 4hdl

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2MZ9)