Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  NMR STRUCTURE AND 1H, 13C AND 15N CHEMICAL SHIFT ASSIGNMENTS FOR HIGH MOBILITY GROUP PROTEIN FROM PLASMODIUM FALCIPARUM 3D7.
 
Authors :  C. Tang, R. Barnwal, G. Varani
Date :  02 Jul 14  (Deposition) - 16 Jul 14  (Release) - 16 Jul 14  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (10x)
NMR Structure *:  A  (1x)
Keywords :  Pathogenesis, Virulence, Protein Binding (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  C. Tang, R. Barnwal, G. Varani
Nmr Structure And 1H, 13C And 15N Chemical Shift Assignment For High Mobility Group Protein From Plasmodium Falciparum 3D7.
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - HIGH MOBILITY GROUP PROTEIN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    Expression System VectorAVA VECTOR
    FragmentUNP RESIDUES 17-99
    GenePFHMGB2, MAL8P1.72
    Organism ScientificPLASMODIUM FALCIPARUM 3D7
    Organism Taxid36329

 Structural Features

(-) Chains, Units

  1
NMR Structure (10x)A
NMR Structure * (1x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 2MRC)

(-) Sites  (0, 0)

(no "Site" information available for 2MRC)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 2MRC)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 2MRC)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 2MRC)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 2MRC)

(-) Exons   (0, 0)

(no "Exon" information available for 2MRC)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:92
 aligned with Q8IB14_PLAF7 | Q8IB14 from UniProtKB/TrEMBL  Length:99

    Alignment length:99
                                    10        20        30        40        50        60        70        80        90         
          Q8IB14_PLAF7    1 MASKSQKKVLKKQNKKKKKDPLAPKRALSAYMFYVKDKRLEIIKEKPELAKDVAQVGKLIGEAWGQLSPAQKAPYEKKAQLDKVRYSKEIEEYRKKNQE 99
               SCOP domains --------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ....-------..................hhhhhhhhhhhhhhhh.......hhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------- Transcript
                  2mrc A  1 MAHH-------HHHHMKKKDPLAPKRALSAYMFYVKDKRLEIIKEKPELAKDVAQVGKLIGEAWGQLSPAQKAPYEKKAQLDKVRYSKEIEEYRKKNQE 92
                               |     - |      13        23        33        43        53        63        73        83         
                               4       5                                                                                       

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 2MRC)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 2MRC)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 2MRC)

(-) Gene Ontology  (7, 7)

NMR Structure(hide GO term definitions)
Chain A   (Q8IB14_PLAF7 | Q8IB14)
molecular function
    GO:0003677    DNA binding    Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
    GO:0008301    DNA binding, bending    The activity of binding selectively and non-covalently to and distorting the original structure of DNA, typically a straight helix, into a bend, or increasing the bend if the original structure was intrinsically bent due to its sequence.
biological process
    GO:0002720    positive regulation of cytokine production involved in immune response    Any process that activates or increases the frequency, rate, or extent of cytokine production that contributes to an immune response.
    GO:0006359    regulation of transcription from RNA polymerase III promoter    Any process that modulates the frequency, rate or extent of transcription from an RNA ploymerase III promoter.
    GO:0006355    regulation of transcription, DNA-templated    Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
cellular component
    GO:0005694    chromosome    A structure composed of a very long molecule of DNA and associated proteins (e.g. histones) that carries hereditary information.
    GO:0005829    cytosol    The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2mrc)
 
  Sites
(no "Sites" information available for 2mrc)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2mrc)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  2mrc
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8IB14_PLAF7 | Q8IB14
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  Q8IB14_PLAF7 | Q8IB14
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 2MRC)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 2MRC)