2MQ3 - JenaLib

NMR Structure - model 1 (Jmol Viewer)

NMR Structure - all models (Jmol Viewer)

Title :   NMR STRUCTURE OF THE C3 DOMAIN OF HUMAN CARDIAC MYOSIN BINDING PROTEIN-C WITH A HYPERTROPHIC CARDIOMYOPATHY-RELATED MUTATION R502W.

Authors :   X. Zhang, S. De, L. P. Mcintosh, M. Paetzel

Date :   12 Jun 14 (Deposition) - 30 Jul 14 (Release) - 27 Aug 14 (Revision)

Method :   SOLUTION NMR

Resolution :   NOT APPLICABLE

Chains :   NMR Structure  : A  (10x)
NMR Structure *: A  (1x)

Keywords :   Cardiac Myosin Binding Protein C, C3 Domain, Ig-Like, Hypertrophic Cardiomyopathy, Contractile Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )

Reference :   X. L. Zhang, S. De, L. P. Mcintosh, M. Paetzel
Structural Characterization Of The C3 Domain Of Cardiac Myosin Binding Protein C And Its Hypertrophic Cardiomyopathy-Related R502W Mutant.
Biochemistry V. 53 5332 2014
PubMed-ID: 25058872 | Reference-DOI: 10.1021/BI500784G

Molecule 1 - MYOSIN-BINDING PROTEIN C, CARDIAC-TYPE
	Chains	:	A
	Engineered	:	YES
	Expression System	:	ESCHERICHIA COLI
	Expression System Plasmid	:	PET28A
	Expression System Taxid	:	562
	Expression System Vector Type	:	PLASMID
	Fragment	:	UNP RESIDUES 453-543
	Gene	:	MYBPC3
	Mutation	:	YES
	Organism Common	:	HUMAN
	Organism Scientific	:	HOMO SAPIENS
	Organism Taxid	:	9606
	Synonym	:	CARDIAC MYBP-C, C-PROTEIN, CARDIAC MUSCLE ISOFORM

		1
NMR Structure (10x)	:	A
NMR Structure * (1x)	:	A

Summary Information (see also Sequences/Alignments below)

(no "Ligand,Modified Residues,Ions" information available for 2MQ3)

(no "Site" information available for 2MQ3)

(no "SS Bond" information available for 2MQ3)

(no "Cis Peptide Bond" information available for 2MQ3)

NMR Structure (12, 12)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_027879	E	451	Q	MYPC3_HUMAN	Disease (CMH4)	---	A	H	451	Q
02	UniProt	VAR_029399	R	458	H	MYPC3_HUMAN	Disease (CMH4)	374255707	A	R	458	H
03	UniProt	VAR_029400	G	490	R	MYPC3_HUMAN	Disease (LVNC10)	200625851	A	G	490	R
04	UniProt	VAR_070451	G	490	V	MYPC3_HUMAN	Disease (CMH4)	397514752	A	G	490	V
05	UniProt	VAR_045929	R	495	G	MYPC3_HUMAN	Disease (CMH4)	397515905	A	R	495	G
06	UniProt	VAR_027880	R	495	Q	MYPC3_HUMAN	Disease (CMH4)	200411226	A	R	495	Q
07	UniProt	VAR_027881	R	502	Q	MYPC3_HUMAN	Disease (CMH4)	397515907	A	W	502	Q
08	UniProt	VAR_019895	R	502	W	MYPC3_HUMAN	Disease (CMH4)	375882485	A	W	502	W
09	UniProt	VAR_029401	G	507	R	MYPC3_HUMAN	Disease (CMH4)	35736435	A	G	507	R
10	UniProt	VAR_020573	A	522	T	MYPC3_HUMAN	Polymorphism	11570082	A	A	522	T
11	UniProt	VAR_029402	G	523	W	MYPC3_HUMAN	Disease (CMH4)	---	A	G	523	W
12	UniProt	VAR_003917	E	542	Q	MYPC3_HUMAN	Disease (CMH4)	121909374	A	E	542	Q

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

NMR Structure * (12, 12)

								dbSNP	PDB
No.	Source	Variant ID	Variant			UniProt ID	Status	ID	Chain	Variant
01	UniProt	VAR_027879	E	451	Q	MYPC3_HUMAN	Disease (CMH4)	---	A	H	451	Q
02	UniProt	VAR_029399	R	458	H	MYPC3_HUMAN	Disease (CMH4)	374255707	A	R	458	H
03	UniProt	VAR_029400	G	490	R	MYPC3_HUMAN	Disease (LVNC10)	200625851	A	G	490	R
04	UniProt	VAR_070451	G	490	V	MYPC3_HUMAN	Disease (CMH4)	397514752	A	G	490	V
05	UniProt	VAR_045929	R	495	G	MYPC3_HUMAN	Disease (CMH4)	397515905	A	R	495	G
06	UniProt	VAR_027880	R	495	Q	MYPC3_HUMAN	Disease (CMH4)	200411226	A	R	495	Q
07	UniProt	VAR_027881	R	502	Q	MYPC3_HUMAN	Disease (CMH4)	397515907	A	W	502	Q
08	UniProt	VAR_019895	R	502	W	MYPC3_HUMAN	Disease (CMH4)	375882485	A	W	502	W
09	UniProt	VAR_029401	G	507	R	MYPC3_HUMAN	Disease (CMH4)	35736435	A	G	507	R
10	UniProt	VAR_020573	A	522	T	MYPC3_HUMAN	Polymorphism	11570082	A	A	522	T
11	UniProt	VAR_029402	G	523	W	MYPC3_HUMAN	Disease (CMH4)	---	A	G	523	W
12	UniProt	VAR_003917	E	542	Q	MYPC3_HUMAN	Disease (CMH4)	121909374	A	E	542	Q

SNP/SAP Summary Statistics (UniProtKB/Swiss-Prot)

(no "PROSITE Motif" information available for 2MQ3)

NMR Structure (5, 5)

	ENSEMBL					UniProtKB			PDB
No.	Transcript ID	Exon	Exon ID	Genome Location	Length	ID	Location	Length	Count	Location	Length
1.1	ENST00000256993	1	ENSE00001304474	chr11:47374253-47374174	80	MYPC3_HUMAN	1-9	9	0	-	-
1.2	ENST00000256993	2	ENSE00001098053	chr11:47373056-47372790	267	MYPC3_HUMAN	9-98	90	0	-	-
1.3	ENST00000256993	3	ENSE00001130147	chr11:47372166-47372053	114	MYPC3_HUMAN	98-136	39	0	-	-
1.4	ENST00000256993	4	ENSE00001098057	chr11:47371663-47371565	99	MYPC3_HUMAN	136-169	34	0	-	-
1.5	ENST00000256993	5	ENSE00001130142	chr11:47371473-47371325	149	MYPC3_HUMAN	169-218	50	0	-	-
1.6	ENST00000256993	6	ENSE00001130136	chr11:47370092-47369975	118	MYPC3_HUMAN	219-258	40	0	-	-
1.7	ENST00000256993	7	ENSE00001098044	chr11:47369456-47369408	49	MYPC3_HUMAN	258-274	17	0	-	-
1.8	ENST00000256993	8	ENSE00001098055	chr11:47369231-47369202	30	MYPC3_HUMAN	274-284	11	0	-	-
1.9	ENST00000256993	9	ENSE00001098039	chr11:47369030-47368977	54	MYPC3_HUMAN	284-302	19	0	-	-
1.10	ENST00000256993	10	ENSE00001098050	chr11:47368198-47368178	21	MYPC3_HUMAN	302-309	8	0	-	-
1.11	ENST00000256993	11	ENSE00001098054	chr11:47367921-47367758	164	MYPC3_HUMAN	309-364	56	0	-	-
1.12	ENST00000256993	12	ENSE00001098049	chr11:47365175-47365043	133	MYPC3_HUMAN	364-408	45	1	A:449-450	2
1.14	ENST00000256993	14	ENSE00001098040	chr11:47364696-47364572	125	MYPC3_HUMAN	408-450	43	1	A:450-450	1
1.15	ENST00000256993	15	ENSE00001098052	chr11:47364486-47364381	106	MYPC3_HUMAN	450-485	36	1	A:451-485	35
1.16	ENST00000256993	16	ENSE00001098059	chr11:47364295-47364129	167	MYPC3_HUMAN	485-541	57	1	A:485-541	57
1.17	ENST00000256993	17	ENSE00001098062	chr11:47363707-47363542	166	MYPC3_HUMAN	541-596	56	1	A:541-543	3
1.18	ENST00000256993	18	ENSE00001130082	chr11:47362795-47362689	107	MYPC3_HUMAN	596-632	37	0	-	-
1.19	ENST00000256993	19	ENSE00001098058	chr11:47362583-47362554	30	MYPC3_HUMAN	632-642	11	0	-	-
1.20	ENST00000256993	20	ENSE00001130073	chr11:47361341-47361202	140	MYPC3_HUMAN	642-688	47	0	-	-
1.21	ENST00000256993	21	ENSE00001130066	chr11:47360955-47360875	81	MYPC3_HUMAN	689-715	27	0	-	-
1.22	ENST00000256993	22	ENSE00001098047	chr11:47360230-47360071	160	MYPC3_HUMAN	716-769	54	0	-	-
1.23	ENST00000256993	23	ENSE00001130054	chr11:47359345-47359241	105	MYPC3_HUMAN	769-804	36	0	-	-
1.24	ENST00000256993	24	ENSE00001130046	chr11:47359130-47358942	189	MYPC3_HUMAN	804-867	64	0	-	-
1.25	ENST00000256993	25	ENSE00001130039	chr11:47357562-47357428	135	MYPC3_HUMAN	867-912	46	0	-	-
1.26	ENST00000256993	26	ENSE00000921276	chr11:47356760-47356593	168	MYPC3_HUMAN	912-968	57	0	-	-
1.27	ENST00000256993	27	ENSE00000921275	chr11:47355561-47355473	89	MYPC3_HUMAN	968-997	30	0	-	-
1.28	ENST00000256993	28	ENSE00000921274	chr11:47355303-47355108	196	MYPC3_HUMAN	998-1063	66	0	-	-
1.29	ENST00000256993	29	ENSE00000921273	chr11:47354884-47354745	140	MYPC3_HUMAN	1063-1109	47	0	-	-
1.30	ENST00000256993	30	ENSE00000921272	chr11:47354524-47354365	160	MYPC3_HUMAN	1110-1163	54	0	-	-
1.31	ENST00000256993	31	ENSE00000921271	chr11:47354253-47354117	137	MYPC3_HUMAN	1163-1208	46	0	-	-
1.32	ENST00000256993	32	ENSE00000921270	chr11:47353809-47353623	187	MYPC3_HUMAN	1209-1271	63	0	-	-
1.33	ENST00000256993	33	ENSE00000921269	chr11:47353432-47353396	37	MYPC3_HUMAN	1271-1273	3	0	-	-
1.34	ENST00000256993	34	ENSE00001129990	chr11:47353267-47352957	311	MYPC3_HUMAN	-	0	0	-	-

NMR Structure

Reformat:	Number of residues per line = ('0' or empty: single-line sequence representation)
	Number of residues per labelling interval =
	UniProt sequence: complete aligned part

Show mapping:	SCOP domains	CATH domains	Pfam domains	Secondary structure (by author)
	SAPs(SNPs)	PROSITE motifs	Exons
	(details for a mapped element are shown in a popup box when the mouse pointer rests over it)

Chain A from PDB  Type:PROTEIN  Length:95
 aligned with MYPC3_HUMAN | Q14896 from UniProtKB/Swiss-Prot  Length:1274

    Alignment length:137
                                   416       426       436       446       456       466       476       486       496       506       516       526       536       
          MYPC3_HUMAN   407 GSKYIFESIGAKRTLTISQCSLADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYRFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEK 543
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..------------------------------------------..............ee....eeee..........eeee..ee........eeeeee..eeeeee..........eeee....eeee...ee.. Sec.struct. author
             SAPs(SNPs) (1) --------------------------------------------Q------H-------------------------------R----G------Q----R--------------TW------------------Q- SAPs(SNPs) (1)
             SAPs(SNPs) (2) -----------------------------------------------------------------------------------V----Q------W----------------------------------------- SAPs(SNPs) (2)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------- PROSITE
           Transcript 1 (1) 1.-----------------------------------------Exon 1.15  PDB: A:451-485           -------------------------------------------------------1.1 Transcript 1 (1)
           Transcript 1 (2) -Exon 1.14  PDB: A:450-450 UniProt: 408-450 ----------------------------------Exon 1.16  PDB: A:485-541 UniProt: 485-541               -- Transcript 1 (2)
                 2mq3 A 449 GS------------------------------------------HMPVLITRPLEDQLVMVGQRVEFECEVSEEGAQVKWLKDGVELTREETFKYWFKKDGQRHHLIINEAMLEDAGHYALCTSGGQALAELIVQEK 543
                             |       -         -         -         -    |  456       466       476       486       496       506       516       526       536       
                             |                                        451                                                                                            
                           450

Legend:		→ Mismatch	(orange background)
	-	→ Gap	(green background, '-', border residues have a numbering label)
		→ Modified Residue	(blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
	x	→ Chemical Group	(purple background, 'x', labelled with number + name, e.g. ACE or NH2)
	extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '\|'

(no "SCOP Domain" information available for 2MQ3)

(no "CATH Domain" information available for 2MQ3)

(no "Pfam Domain" information available for 2MQ3)

NMR Structure(hide GO term definitions)

Chain A (MYPC3_HUMAN | Q14896)

molecular function
	GO:0001671	ATPase activator activity	Binds to and increases the ATP hydrolysis activity of an ATPase.
	GO:0003779	actin binding	Interacting selectively and non-covalently with monomeric or multimeric forms of actin, including actin filaments.
	GO:0042802	identical protein binding	Interacting selectively and non-covalently with an identical protein or proteins.
	GO:0046872	metal ion binding	Interacting selectively and non-covalently with any metal ion.
	GO:0017022	myosin binding	Interacting selectively and non-covalently with any part of a myosin complex; myosins are any of a superfamily of molecular motor proteins that bind to actin and use the energy of ATP hydrolysis to generate force and movement along actin filaments.
	GO:0032036	myosin heavy chain binding	Interacting selectively and non-covalently with a heavy chain of a myosin complex.
	GO:0005515	protein binding	Interacting selectively and non-covalently with any protein or protein complex (a complex of two or more proteins that may include other nonprotein molecules).
	GO:0008307	structural constituent of muscle	The action of a molecule that contributes to the structural integrity of a muscle fiber.
	GO:0031432	titin binding	Interacting selectively and non-covalently with titin, any of a family of giant proteins found in striated and smooth muscle. In striated muscle, single titin molecules span half the sarcomere, with their N- and C-termini in the Z-disc and M-line, respectively.
biological process
	GO:0060048	cardiac muscle contraction	Muscle contraction of cardiac muscle tissue.
	GO:0007155	cell adhesion	The attachment of a cell, either to another cell or to an underlying substrate such as the extracellular matrix, via cell adhesion molecules.
	GO:0003007	heart morphogenesis	The developmental process in which the heart is generated and organized. The heart is a hollow, muscular organ, which, by contracting rhythmically, keeps up the circulation of the blood.
	GO:0030049	muscle filament sliding	The sliding of actin thin filaments and myosin thick filaments past each other in muscle contraction. This involves a process of interaction of myosin located on a thick filament with actin located on a thin filament. During this process ATP is split and forces are generated.
	GO:0032781	positive regulation of ATPase activity	Any process that activates or increases the rate of ATP hydrolysis by an ATPase.
	GO:0032971	regulation of muscle filament sliding	Any process that modulates the frequency, rate or extent of muscle filament sliding.
	GO:0006942	regulation of striated muscle contraction	Any process that modulates the frequency, rate or extent of striated muscle contraction.
	GO:0055010	ventricular cardiac muscle tissue morphogenesis	The process in which the anatomical structures of cardiac ventricle muscle is generated and organized.
cellular component
	GO:0031672	A band	The dark-staining region of a sarcomere, in which myosin thick filaments are present; the center is traversed by the paler H zone, which in turn contains the M line.
	GO:0014705	C zone	A region of the A band in which myosin-binding protein C is located and that can be seen by electron microscopy. This is a functional zone that also includes myosin.
	GO:0005829	cytosol	The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
	GO:0032982	myosin filament	A protein complex containing myosin heavy chains, plus associated light chains and other proteins, in which the myosin heavy chains are arranged into a filament.
	GO:0030017	sarcomere	The repeating unit of a myofibril in a muscle cell, composed of an array of overlapping thick and thin filaments between two adjacent Z discs.
	GO:0005863	striated muscle myosin thick filament	Bipolar filaments formed of polymers of a muscle-specific myosin II isoform, found in the middle of sarcomeres in myofibrils.

NMR Structure
	Complete Structure
		Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
		WebMol \| AstexViewer[tm]@PDBe (Java Applets, require no local installation except for Java; loading may be slow)
		STRAP (Java WebStart application, automatic local installation, requires Java; full application with system access!)
		RasMol (require local installation)
		Molscript (VRML) (requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)

	Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 2mq3)

	Sites
(no "Sites" information available for 2mq3)

	Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 2mq3)

Jmol
	protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick [ NMR Structure - model 1 PNG format \| NMR Structure - all models PNG format ](automatic orientation, automatically generated)
Molscript
	protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick [ mono PDF format \| stereo PDF format ](default orientation, automatically generated)

Access by PDB/NDB ID
	2mq3
		Family and Domain Information	:	ProDom \| SYSTERS
		General Structural Information	:	GlycoscienceDB \| MMDB \| NDB \| OCA \| PDB \| PDBe \| PDBj \| PDBsum \| PDBWiki \| PQS \| PROTEOPEDIA
		Orientation in Membranes	:	OPM
		Protein Surface	:	SURFACE
		Secondary Structure	:	DSSP (structure derived) \| HSSP (homology derived)
		Structural Genomics	:	GeneCensus
		Structural Neighbours	:	CE \| VAST
		Structure Classification	:	CATH \| Dali \| SCOP
		Validation and Original Data	:	BMRB Data View \| BMRB Restraints Grid \| EDS \| PROCHECK \| RECOORD \| WHAT_CHECK

Access by UniProt ID/Accession number
	MYPC3_HUMAN \| Q14896
		Comparative Protein Structure Models	:	ModBase
		Genomic Information	:	Ensembl
		Protein-protein Interaction	:	DIP
		Sequence, Family and Domain Information	:	InterPro \| Pfam \| SMART \| UniProtKB/SwissProt

Access by Enzyme Classificator (EC Number)
	(no 'Enzyme Classificator' available)
		General Enzyme Information	:	BRENDA \| EC-PDB \| Enzyme \| IntEnz
		Pathway	:	KEGG \| MetaCyc

Access by Disease Identifier (MIM ID)
	115197
		Disease Information	:	OMIM
	615396
		Disease Information	:	OMIM

Access by GenAge ID
	(no 'GenAge ID' available)
		Age Related Information	:	GenAge

Access by PDB/NDB ID
		Domain Information	:	XDom
		Interatomic Contacts of Structural Units	:	CSU
		Ligand-protein Contacts	:	LPC
		Protein Cavities	:	castP
		Sequence and Secondary Structure	:	PDBCartoon
		Structure Alignment	:	STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
		Structure and Sequence Browser	:	STING

Access by UniProt ID/Accession number
	MYPC3_HUMAN \| Q14896
		Protein Disorder Prediction	:	DisEMBL \| FoldIndex \| GLOBPLOT (for more information see DisProt)

UniProtKB/Swiss-Prot
	MYPC3_HUMAN \| Q14896	:	1gxe 1pd6 2avg 2k1m 2mq0 2v6h 3cx2 5k6p

2mq0	STRUCTURAL CHARACTERIZATION OF THE WILD-TYPE C3 DOMAIN OF CARDIAC MYOSIN BINDING PROTEIN-C RELATED ID: 25007 RELATED DB: BMRB STRUCTURAL CHARACTERIZATION OF THE WILD-TYPE C3 DOMAIN OF CARDIAC MYOSIN BINDING PROTEIN-C RELATED ID: 25010 RELATED DB: BMRB

Description

Compounds

Structural Features

Chains, Units

Ligands, Modified Residues, Ions (0, 0)

Sites (0, 0)

SS Bonds (0, 0)

Cis Peptide Bonds (0, 0)

Sequence-Structure Mapping

SAPs(SNPs)/Variants (12, 12)

PROSITE Motifs (0, 0)

Exons (5, 5)

Sequences/Alignments

Classification and Annotation

SCOP Domains (0, 0)

CATH Domains (0, 0)

Pfam Domains (0, 0)

Gene Ontology (23, 23)

Visualization

Interactive Views

Still Images

Databases and Analysis Tools

Databases

Analysis Tools

Related Entries

Entries Sharing at Least One Protein Chain (UniProt ID)

Related Entries Specified in the PDB File