|
|
|
|
|
Description|
|
Compounds
|
||||||||||||||||||||||||||||||||||||||||||||
Chains, Units
Summary Information (see also Sequences/Alignments below) |
Ligands, Modified Residues, Ions (0, 0)| (no "Ligand,Modified Residues,Ions" information available for 2MOI) |
Sites (0, 0)| (no "Site" information available for 2MOI) |
SS Bonds (0, 0)| (no "SS Bond" information available for 2MOI) |
Cis Peptide Bonds (1, 10)
NMR Structure
|
||||||||||
SAPs(SNPs)/Variants (0, 0)| (no "SAP(SNP)/Variant" information available for 2MOI) |
PROSITE Motifs (1, 1)
NMR Structure (1, 1)
|
||||||||||||||||||||||||||||||||||||||||||||||||
Exons (0, 0)| (no "Exon" information available for 2MOI) |
Sequences/Alignments
NMR StructureChain A from PDB Type:PROTEIN Length:108 aligned with YGAP_ECOLI | P55734 from UniProtKB/Swiss-Prot Length:174 Alignment length:108 11 21 31 41 51 61 71 81 91 101 YGAP_ECOLI 2 ALTTISPHDAQELIARGAKLIDIRDADEYLREHIPEADLAPLSVLEQSGLPAKLRHEQIIFHCQAGKRTSNNADKLAAIAAPAEIFLLEDGIDGWKKAGLPVAVNKSQ 109 SCOP domains ------------------------------------------------------------------------------------------------------------ SCOP domains CATH domains ------------------------------------------------------------------------------------------------------------ CATH domains Pfam domains ------------------------------------------------------------------------------------------------------------ Pfam domains SAPs(SNPs) ------------------------------------------------------------------------------------------------------------ SAPs(SNPs) PROSITE -------------RHODANESE_3 PDB: A:14-104 UniProt: 15-105 ---- PROSITE Transcript ------------------------------------------------------------------------------------------------------------ Transcript 2moi A 1 ALTTISPHDAQELIARGAKLIDIRDADEYLREHIPEADLAPLSVLEQSGLPAKLRHEQIIFHCQAGKRTSNNADKLAAIAAPAEIFLLEDGIDGWKKAGLPVAVNKSQ 108 10 20 30 40 50 60 70 80 90 100
|
||||||||||||||||||||
SCOP Domains (0, 0)| (no "SCOP Domain" information available for 2MOI) |
CATH Domains (0, 0)| (no "CATH Domain" information available for 2MOI) |
Pfam Domains (0, 0)| (no "Pfam Domain" information available for 2MOI) |
Gene Ontology (5, 5)|
NMR Structure(hide GO term definitions) Chain A (YGAP_ECOLI | P55734)
|
||||||||||||||||||||||||||||||||||||||||||
Interactive Views
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Still Images
|
||||||||||||||||
Databases
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Analysis Tools
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entries Sharing at Least One Protein Chain (UniProt ID)
Related Entries Specified in the PDB File
|
|